Cargando…
Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese he...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9467799/ https://www.ncbi.nlm.nih.gov/pubmed/36106027 http://dx.doi.org/10.1155/2022/6382205 |
_version_ | 1784788270421377024 |
---|---|
author | Wang, Yan Huang, Yefang Shi, Ling Huang, Li Wen, Yi Cao, Yihong Yang, Zi Liu, Qian Yin, Xiaolan Ji, Xiaoli |
author_facet | Wang, Yan Huang, Yefang Shi, Ling Huang, Li Wen, Yi Cao, Yihong Yang, Zi Liu, Qian Yin, Xiaolan Ji, Xiaoli |
author_sort | Wang, Yan |
collection | PubMed |
description | Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese herbal formula, on SPID using a SPID rat model. Mixed bacterial infection and mechanical injury were used for modeling. The chemical composition of SSD was analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS). The inflammatory factors were detected by enzyme-linked immunosorbent assay (ELISA) and western blot techniques. We found that SSD dose-dependently inhibited the content of IL-18, IL-1β, TNF-α, and IL-6 in serum samples of SPID rats. The results from the hematoxylin and eosin (H&E) stain showed that SSD improved pathological injury of the uterus and fallopian tubes induced by a pathogen. In addition, SSD dose-dependently inhibited mitochondrial dysfunction and oxidative stress of SPID rats. The expression of SIRT1 was promoted, and NLRP3 inflammasome was deactivated by SSD gavage compared with the SPID group. Specifically, SIRT1 inhibitor EX-527 cotreatment significantly reversed the improvement effect of SSD on pelvic inflammatory disease in rats. Taken together, the results of this study suggest that Shipi Shugan Decoction may be an effective TCM for the treatment of SPID. |
format | Online Article Text |
id | pubmed-9467799 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-94677992022-09-13 Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats Wang, Yan Huang, Yefang Shi, Ling Huang, Li Wen, Yi Cao, Yihong Yang, Zi Liu, Qian Yin, Xiaolan Ji, Xiaoli Evid Based Complement Alternat Med Research Article Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese herbal formula, on SPID using a SPID rat model. Mixed bacterial infection and mechanical injury were used for modeling. The chemical composition of SSD was analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS). The inflammatory factors were detected by enzyme-linked immunosorbent assay (ELISA) and western blot techniques. We found that SSD dose-dependently inhibited the content of IL-18, IL-1β, TNF-α, and IL-6 in serum samples of SPID rats. The results from the hematoxylin and eosin (H&E) stain showed that SSD improved pathological injury of the uterus and fallopian tubes induced by a pathogen. In addition, SSD dose-dependently inhibited mitochondrial dysfunction and oxidative stress of SPID rats. The expression of SIRT1 was promoted, and NLRP3 inflammasome was deactivated by SSD gavage compared with the SPID group. Specifically, SIRT1 inhibitor EX-527 cotreatment significantly reversed the improvement effect of SSD on pelvic inflammatory disease in rats. Taken together, the results of this study suggest that Shipi Shugan Decoction may be an effective TCM for the treatment of SPID. Hindawi 2022-09-05 /pmc/articles/PMC9467799/ /pubmed/36106027 http://dx.doi.org/10.1155/2022/6382205 Text en Copyright © 2022 Yan Wang et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Wang, Yan Huang, Yefang Shi, Ling Huang, Li Wen, Yi Cao, Yihong Yang, Zi Liu, Qian Yin, Xiaolan Ji, Xiaoli Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title | Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title_full | Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title_fullStr | Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title_full_unstemmed | Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title_short | Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats |
title_sort | shipi shugan decoction protected against sequela of pelvic inflammatory disease via inhibiting sirt1/nlrp3 signaling pathway in pelvic inflammatory disease rats |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9467799/ https://www.ncbi.nlm.nih.gov/pubmed/36106027 http://dx.doi.org/10.1155/2022/6382205 |
work_keys_str_mv | AT wangyan shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT huangyefang shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT shiling shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT huangli shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT wenyi shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT caoyihong shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT yangzi shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT liuqian shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT yinxiaolan shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats AT jixiaoli shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats |