Cargando…

Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats

Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese he...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Yan, Huang, Yefang, Shi, Ling, Huang, Li, Wen, Yi, Cao, Yihong, Yang, Zi, Liu, Qian, Yin, Xiaolan, Ji, Xiaoli
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9467799/
https://www.ncbi.nlm.nih.gov/pubmed/36106027
http://dx.doi.org/10.1155/2022/6382205
_version_ 1784788270421377024
author Wang, Yan
Huang, Yefang
Shi, Ling
Huang, Li
Wen, Yi
Cao, Yihong
Yang, Zi
Liu, Qian
Yin, Xiaolan
Ji, Xiaoli
author_facet Wang, Yan
Huang, Yefang
Shi, Ling
Huang, Li
Wen, Yi
Cao, Yihong
Yang, Zi
Liu, Qian
Yin, Xiaolan
Ji, Xiaoli
author_sort Wang, Yan
collection PubMed
description Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese herbal formula, on SPID using a SPID rat model. Mixed bacterial infection and mechanical injury were used for modeling. The chemical composition of SSD was analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS). The inflammatory factors were detected by enzyme-linked immunosorbent assay (ELISA) and western blot techniques. We found that SSD dose-dependently inhibited the content of IL-18, IL-1β, TNF-α, and IL-6 in serum samples of SPID rats. The results from the hematoxylin and eosin (H&E) stain showed that SSD improved pathological injury of the uterus and fallopian tubes induced by a pathogen. In addition, SSD dose-dependently inhibited mitochondrial dysfunction and oxidative stress of SPID rats. The expression of SIRT1 was promoted, and NLRP3 inflammasome was deactivated by SSD gavage compared with the SPID group. Specifically, SIRT1 inhibitor EX-527 cotreatment significantly reversed the improvement effect of SSD on pelvic inflammatory disease in rats. Taken together, the results of this study suggest that Shipi Shugan Decoction may be an effective TCM for the treatment of SPID.
format Online
Article
Text
id pubmed-9467799
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-94677992022-09-13 Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats Wang, Yan Huang, Yefang Shi, Ling Huang, Li Wen, Yi Cao, Yihong Yang, Zi Liu, Qian Yin, Xiaolan Ji, Xiaoli Evid Based Complement Alternat Med Research Article Sequela of pelvic inflammatory disease (SPID) is a common and frequently occurring disease clinically. Traditional Chinese medicine (TCM) provided unique advantages in the treatment of SPID. In this study, we aimed to investigate the protective mechanism of Shipi Shugan Decoction (SSD), a Chinese herbal formula, on SPID using a SPID rat model. Mixed bacterial infection and mechanical injury were used for modeling. The chemical composition of SSD was analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS). The inflammatory factors were detected by enzyme-linked immunosorbent assay (ELISA) and western blot techniques. We found that SSD dose-dependently inhibited the content of IL-18, IL-1β, TNF-α, and IL-6 in serum samples of SPID rats. The results from the hematoxylin and eosin (H&E) stain showed that SSD improved pathological injury of the uterus and fallopian tubes induced by a pathogen. In addition, SSD dose-dependently inhibited mitochondrial dysfunction and oxidative stress of SPID rats. The expression of SIRT1 was promoted, and NLRP3 inflammasome was deactivated by SSD gavage compared with the SPID group. Specifically, SIRT1 inhibitor EX-527 cotreatment significantly reversed the improvement effect of SSD on pelvic inflammatory disease in rats. Taken together, the results of this study suggest that Shipi Shugan Decoction may be an effective TCM for the treatment of SPID. Hindawi 2022-09-05 /pmc/articles/PMC9467799/ /pubmed/36106027 http://dx.doi.org/10.1155/2022/6382205 Text en Copyright © 2022 Yan Wang et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Wang, Yan
Huang, Yefang
Shi, Ling
Huang, Li
Wen, Yi
Cao, Yihong
Yang, Zi
Liu, Qian
Yin, Xiaolan
Ji, Xiaoli
Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title_full Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title_fullStr Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title_full_unstemmed Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title_short Shipi Shugan Decoction Protected against Sequela of Pelvic Inflammatory Disease via Inhibiting SIRT1/NLRP3 Signaling Pathway in Pelvic Inflammatory Disease Rats
title_sort shipi shugan decoction protected against sequela of pelvic inflammatory disease via inhibiting sirt1/nlrp3 signaling pathway in pelvic inflammatory disease rats
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9467799/
https://www.ncbi.nlm.nih.gov/pubmed/36106027
http://dx.doi.org/10.1155/2022/6382205
work_keys_str_mv AT wangyan shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT huangyefang shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT shiling shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT huangli shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT wenyi shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT caoyihong shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT yangzi shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT liuqian shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT yinxiaolan shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats
AT jixiaoli shipishugandecoctionprotectedagainstsequelaofpelvicinflammatorydiseaseviainhibitingsirt1nlrp3signalingpathwayinpelvicinflammatorydiseaserats