Cargando…
Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability
CaMKIIα plays a fundamental role in learning and memory and is a key determinant of synaptic plasticity. Its kinase activity is regulated by the binding of Ca(2+)/CaM and by autophosphorylation that operates in an activity-dependent manner. Though many mutations in CAMK2A were linked to a variety of...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9474683/ https://www.ncbi.nlm.nih.gov/pubmed/36117912 http://dx.doi.org/10.3389/fnmol.2022.970031 |
_version_ | 1784789757876764672 |
---|---|
author | Fujii, Hajime Kidokoro, Hiroyuki Kondo, Yayoi Kawaguchi, Masahiro Horigane, Shin-ichiro Natsume, Jun Takemoto-Kimura, Sayaka Bito, Haruhiko |
author_facet | Fujii, Hajime Kidokoro, Hiroyuki Kondo, Yayoi Kawaguchi, Masahiro Horigane, Shin-ichiro Natsume, Jun Takemoto-Kimura, Sayaka Bito, Haruhiko |
author_sort | Fujii, Hajime |
collection | PubMed |
description | CaMKIIα plays a fundamental role in learning and memory and is a key determinant of synaptic plasticity. Its kinase activity is regulated by the binding of Ca(2+)/CaM and by autophosphorylation that operates in an activity-dependent manner. Though many mutations in CAMK2A were linked to a variety of neurological disorders, the multiplicity of its functional substrates renders the systematic molecular phenotyping challenging. In this study, we report a new case of CAMK2A P212L, a recurrent mutation, in a patient with an intellectual disability. To quantify the effect of this mutation, we developed a FRET-based kinase phenotyping strategy and measured aberrance in Ca(2+)/CaM-dependent activation dynamics in vitro and in synaptically connected neurons. CaMKIIα P212L revealed a significantly facilitated Ca(2+)/CaM-dependent activation in vitro. Consistently, this mutant showed faster activation and more delayed inactivation in neurons. More prolonged kinase activation was also accompanied by a leftward shift in the CaMKIIα input frequency tuning curve. In keeping with this, molecular phenotyping of other reported CAMK2A de novo mutations linked to intellectual disability revealed aberrant facilitation of Ca(2+)/CaM-dependent activation of CaMKIIα in most cases. Finally, the pharmacological reversal of CAMK2A P212L phenotype in neurons was demonstrated using an FDA-approved NMDA receptor antagonist memantine, providing a basis for targeted therapeutics in CAMK2A-linked intellectual disability. Taken together, FRET-based kinase mutation phenotyping sheds light on the biological impact of CAMK2A mutations and provides a selective, sensitive, quantitative, and scalable strategy for gaining novel insights into the molecular etiology of intellectual disability. |
format | Online Article Text |
id | pubmed-9474683 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-94746832022-09-16 Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability Fujii, Hajime Kidokoro, Hiroyuki Kondo, Yayoi Kawaguchi, Masahiro Horigane, Shin-ichiro Natsume, Jun Takemoto-Kimura, Sayaka Bito, Haruhiko Front Mol Neurosci Molecular Neuroscience CaMKIIα plays a fundamental role in learning and memory and is a key determinant of synaptic plasticity. Its kinase activity is regulated by the binding of Ca(2+)/CaM and by autophosphorylation that operates in an activity-dependent manner. Though many mutations in CAMK2A were linked to a variety of neurological disorders, the multiplicity of its functional substrates renders the systematic molecular phenotyping challenging. In this study, we report a new case of CAMK2A P212L, a recurrent mutation, in a patient with an intellectual disability. To quantify the effect of this mutation, we developed a FRET-based kinase phenotyping strategy and measured aberrance in Ca(2+)/CaM-dependent activation dynamics in vitro and in synaptically connected neurons. CaMKIIα P212L revealed a significantly facilitated Ca(2+)/CaM-dependent activation in vitro. Consistently, this mutant showed faster activation and more delayed inactivation in neurons. More prolonged kinase activation was also accompanied by a leftward shift in the CaMKIIα input frequency tuning curve. In keeping with this, molecular phenotyping of other reported CAMK2A de novo mutations linked to intellectual disability revealed aberrant facilitation of Ca(2+)/CaM-dependent activation of CaMKIIα in most cases. Finally, the pharmacological reversal of CAMK2A P212L phenotype in neurons was demonstrated using an FDA-approved NMDA receptor antagonist memantine, providing a basis for targeted therapeutics in CAMK2A-linked intellectual disability. Taken together, FRET-based kinase mutation phenotyping sheds light on the biological impact of CAMK2A mutations and provides a selective, sensitive, quantitative, and scalable strategy for gaining novel insights into the molecular etiology of intellectual disability. Frontiers Media S.A. 2022-09-01 /pmc/articles/PMC9474683/ /pubmed/36117912 http://dx.doi.org/10.3389/fnmol.2022.970031 Text en Copyright © 2022 Fujii, Kidokoro, Kondo, Kawaguchi, Horigane, Natsume, Takemoto-Kimura and Bito. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Molecular Neuroscience Fujii, Hajime Kidokoro, Hiroyuki Kondo, Yayoi Kawaguchi, Masahiro Horigane, Shin-ichiro Natsume, Jun Takemoto-Kimura, Sayaka Bito, Haruhiko Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title | Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title_full | Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title_fullStr | Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title_full_unstemmed | Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title_short | Förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of Ca(2+)/calmodulin-dependent CaMKIIα activity in de novo mutations related to intellectual disability |
title_sort | förster resonance energy transfer-based kinase mutation phenotyping reveals an aberrant facilitation of ca(2+)/calmodulin-dependent camkiiα activity in de novo mutations related to intellectual disability |
topic | Molecular Neuroscience |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9474683/ https://www.ncbi.nlm.nih.gov/pubmed/36117912 http://dx.doi.org/10.3389/fnmol.2022.970031 |
work_keys_str_mv | AT fujiihajime forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT kidokorohiroyuki forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT kondoyayoi forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT kawaguchimasahiro forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT horiganeshinichiro forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT natsumejun forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT takemotokimurasayaka forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability AT bitoharuhiko forsterresonanceenergytransferbasedkinasemutationphenotypingrevealsanaberrantfacilitationofca2calmodulindependentcamkiiaactivityindenovomutationsrelatedtointellectualdisability |