Cargando…

Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination

BACKGROUND: BBIBP-CorV and CoronaVac inactivated COVID-19 vaccines are widely-used, World Health Organization-emergency-listed vaccines. Understanding antibody level changes over time after vaccination is important for booster dose policies. We evaluated neutralizing antibody (nAb) titers and associ...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Fuzhen, Huang, Baoying, Lv, Huakun, Feng, Lizhong, Ren, Weihong, Wang, Xiaoqi, Tang, Lin, Liu, Qianqian, Wu, Dan, Zheng, Hui, An, Zhijie, Deng, Yao, Zhao, Li, Ye, Fei, Wang, Wenling, Zhang, Hangjie, Chang, Shaoying, Liao, Yuting, Chen, Fengyang, Rodewald, Lance E., Gao, George F., Yin, Zundong, Tan, Wenjie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9501884/
https://www.ncbi.nlm.nih.gov/pubmed/36159863
http://dx.doi.org/10.3389/fimmu.2022.967051
_version_ 1784795576828690432
author Wang, Fuzhen
Huang, Baoying
Lv, Huakun
Feng, Lizhong
Ren, Weihong
Wang, Xiaoqi
Tang, Lin
Liu, Qianqian
Wu, Dan
Zheng, Hui
An, Zhijie
Deng, Yao
Zhao, Li
Ye, Fei
Wang, Wenling
Zhang, Hangjie
Chang, Shaoying
Liao, Yuting
Chen, Fengyang
Rodewald, Lance E.
Gao, George F.
Yin, Zundong
Tan, Wenjie
author_facet Wang, Fuzhen
Huang, Baoying
Lv, Huakun
Feng, Lizhong
Ren, Weihong
Wang, Xiaoqi
Tang, Lin
Liu, Qianqian
Wu, Dan
Zheng, Hui
An, Zhijie
Deng, Yao
Zhao, Li
Ye, Fei
Wang, Wenling
Zhang, Hangjie
Chang, Shaoying
Liao, Yuting
Chen, Fengyang
Rodewald, Lance E.
Gao, George F.
Yin, Zundong
Tan, Wenjie
author_sort Wang, Fuzhen
collection PubMed
description BACKGROUND: BBIBP-CorV and CoronaVac inactivated COVID-19 vaccines are widely-used, World Health Organization-emergency-listed vaccines. Understanding antibody level changes over time after vaccination is important for booster dose policies. We evaluated neutralizing antibody (nAb) titers and associated factors for the first 12 months after primary-series vaccination with BBIBP-CorV and CoronaVac. METHODS: Our study consisted of a set of cross-sectional sero-surveys in Zhejiang and Shanxi provinces, China. In 2021, we enrolled 1,527 consenting 18-59-year-olds who received two doses of BBIBP-CorV or CoronaVac 1, 3, 6, 9, or 12 months earlier and obtained blood samples and demographic and medical data. We obtained 6-month convalescent sera from 62 individuals in Hebei province. Serum nAb titers were measured by standard micro-neutralization cytopathic effect assay in Vero cells with ancestral SARS-CoV-2 strain HB01. We used the first WHO International Standard (IS) for anti-SARS-CoV-2 immunoglobulin (NIBSC code 20/136) to standardized geometric mean concentrations (IU/mL) derived from the nAb geometric mean titers (GMT over 1:4 was considered seropositive). We analyzed nAb titer trends using Chi-square and factors related to nAb titers with logistic regression and linear models. RESULTS: Numbers of subjects in each of the five month-groupings ranged from 100 to 200 for each vaccine and met group-specific target sample sizes. Seropositivity rates from BBIBP-CorV were 98.0% at 1 month and 53.5% at 12 months, and GMTs were 25.0 and 4.0. Respective seropositivity rates from CoronaVac were 90.0% and 62.5%, and GMTs were 20.2 and 4.1. One-, three-, six-, nine-, and twelve-month GMCs were 217.2, 84.1, 85.7, 44.6, and 10.9 IU/mL in BBIBP-CorV recipients and 195.7, 94.6, 51.7, 27.6, and 13.4 IU/mL in CoronaVac recipients. Six-month convalescent seropositivity was 95.2%; GMC was 108.9 IU/mL. Seropositivity and GMCs were associated with age, sex, and time since vaccination. CONCLUSIONS: Neutralizing Ab levels against ancestral SARS-CoV-2 from BBIBP-CorV or CoronaVac vaccination were similar and decreased with increasing time since vaccination; over half of 12-month post-vaccination subjects were seropositive. Seropositivity and GMCs from BBIBP-CorV and CoronaVac six and nine months after vaccination were similar to or slightly lower than in six-month convalescent sera. These real-world data suggest necessity of six-month booster doses.
format Online
Article
Text
id pubmed-9501884
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-95018842022-09-24 Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination Wang, Fuzhen Huang, Baoying Lv, Huakun Feng, Lizhong Ren, Weihong Wang, Xiaoqi Tang, Lin Liu, Qianqian Wu, Dan Zheng, Hui An, Zhijie Deng, Yao Zhao, Li Ye, Fei Wang, Wenling Zhang, Hangjie Chang, Shaoying Liao, Yuting Chen, Fengyang Rodewald, Lance E. Gao, George F. Yin, Zundong Tan, Wenjie Front Immunol Immunology BACKGROUND: BBIBP-CorV and CoronaVac inactivated COVID-19 vaccines are widely-used, World Health Organization-emergency-listed vaccines. Understanding antibody level changes over time after vaccination is important for booster dose policies. We evaluated neutralizing antibody (nAb) titers and associated factors for the first 12 months after primary-series vaccination with BBIBP-CorV and CoronaVac. METHODS: Our study consisted of a set of cross-sectional sero-surveys in Zhejiang and Shanxi provinces, China. In 2021, we enrolled 1,527 consenting 18-59-year-olds who received two doses of BBIBP-CorV or CoronaVac 1, 3, 6, 9, or 12 months earlier and obtained blood samples and demographic and medical data. We obtained 6-month convalescent sera from 62 individuals in Hebei province. Serum nAb titers were measured by standard micro-neutralization cytopathic effect assay in Vero cells with ancestral SARS-CoV-2 strain HB01. We used the first WHO International Standard (IS) for anti-SARS-CoV-2 immunoglobulin (NIBSC code 20/136) to standardized geometric mean concentrations (IU/mL) derived from the nAb geometric mean titers (GMT over 1:4 was considered seropositive). We analyzed nAb titer trends using Chi-square and factors related to nAb titers with logistic regression and linear models. RESULTS: Numbers of subjects in each of the five month-groupings ranged from 100 to 200 for each vaccine and met group-specific target sample sizes. Seropositivity rates from BBIBP-CorV were 98.0% at 1 month and 53.5% at 12 months, and GMTs were 25.0 and 4.0. Respective seropositivity rates from CoronaVac were 90.0% and 62.5%, and GMTs were 20.2 and 4.1. One-, three-, six-, nine-, and twelve-month GMCs were 217.2, 84.1, 85.7, 44.6, and 10.9 IU/mL in BBIBP-CorV recipients and 195.7, 94.6, 51.7, 27.6, and 13.4 IU/mL in CoronaVac recipients. Six-month convalescent seropositivity was 95.2%; GMC was 108.9 IU/mL. Seropositivity and GMCs were associated with age, sex, and time since vaccination. CONCLUSIONS: Neutralizing Ab levels against ancestral SARS-CoV-2 from BBIBP-CorV or CoronaVac vaccination were similar and decreased with increasing time since vaccination; over half of 12-month post-vaccination subjects were seropositive. Seropositivity and GMCs from BBIBP-CorV and CoronaVac six and nine months after vaccination were similar to or slightly lower than in six-month convalescent sera. These real-world data suggest necessity of six-month booster doses. Frontiers Media S.A. 2022-09-09 /pmc/articles/PMC9501884/ /pubmed/36159863 http://dx.doi.org/10.3389/fimmu.2022.967051 Text en Copyright © 2022 Wang, Huang, Lv, Feng, Ren, Wang, Tang, Liu, Wu, Zheng, An, Deng, Zhao, Ye, Wang, Zhang, Chang, Liao, Chen, Rodewald, Gao, Yin and Tan https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Immunology
Wang, Fuzhen
Huang, Baoying
Lv, Huakun
Feng, Lizhong
Ren, Weihong
Wang, Xiaoqi
Tang, Lin
Liu, Qianqian
Wu, Dan
Zheng, Hui
An, Zhijie
Deng, Yao
Zhao, Li
Ye, Fei
Wang, Wenling
Zhang, Hangjie
Chang, Shaoying
Liao, Yuting
Chen, Fengyang
Rodewald, Lance E.
Gao, George F.
Yin, Zundong
Tan, Wenjie
Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title_full Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title_fullStr Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title_full_unstemmed Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title_short Factors associated with neutralizing antibody levels induced by two inactivated COVID-19 vaccines for 12 months after primary series vaccination
title_sort factors associated with neutralizing antibody levels induced by two inactivated covid-19 vaccines for 12 months after primary series vaccination
topic Immunology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9501884/
https://www.ncbi.nlm.nih.gov/pubmed/36159863
http://dx.doi.org/10.3389/fimmu.2022.967051
work_keys_str_mv AT wangfuzhen factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT huangbaoying factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT lvhuakun factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT fenglizhong factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT renweihong factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT wangxiaoqi factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT tanglin factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT liuqianqian factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT wudan factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT zhenghui factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT anzhijie factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT dengyao factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT zhaoli factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT yefei factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT wangwenling factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT zhanghangjie factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT changshaoying factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT liaoyuting factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT chenfengyang factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT rodewaldlancee factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT gaogeorgef factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT yinzundong factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination
AT tanwenjie factorsassociatedwithneutralizingantibodylevelsinducedbytwoinactivatedcovid19vaccinesfor12monthsafterprimaryseriesvaccination