Cargando…

Reference values for diaphragm electrical activity (Edi) in newborn infants

BACKGROUND: Neurally adjusted ventilatory assist is an emerging mode of respiratory support that uses the electrical activity of the diaphragm (Edi) to provide synchronised inspiratory pressure support, proportional to an infant’s changing inspiratory effort. Data on Edi reference values for neonate...

Descripción completa

Detalles Bibliográficos
Autores principales: Gurumahan, Varappriyangga, Thavalingam, Sriganesh, Schindler, Tim, Smyth, John, Lui, Kei, Bolisetty, Srinivas
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9502911/
https://www.ncbi.nlm.nih.gov/pubmed/36151518
http://dx.doi.org/10.1186/s12887-022-03619-1
_version_ 1784795831550869504
author Gurumahan, Varappriyangga
Thavalingam, Sriganesh
Schindler, Tim
Smyth, John
Lui, Kei
Bolisetty, Srinivas
author_facet Gurumahan, Varappriyangga
Thavalingam, Sriganesh
Schindler, Tim
Smyth, John
Lui, Kei
Bolisetty, Srinivas
author_sort Gurumahan, Varappriyangga
collection PubMed
description BACKGROUND: Neurally adjusted ventilatory assist is an emerging mode of respiratory support that uses the electrical activity of the diaphragm (Edi) to provide synchronised inspiratory pressure support, proportional to an infant’s changing inspiratory effort. Data on Edi reference values for neonates are limited. The objective of this study was to establish reference Edi values for preterm and term neonates who are not receiving respiratory support. METHODS: This was a prospective observational study of newborn infants breathing spontaneously in room air. The Edi waveform was monitored by a specialised naso/orogastric feeding tube with embedded electrodes positioned at the level of the diaphragm. Edi minimums and peaks were recorded continuously for 4 h without changes to routine clinical handling. RESULTS: Twenty-four newborn infants (16 preterm [< 37 weeks’ gestation]; 8 term) were studied. All infants were breathing comfortably in room air at the time of study. Edi data were successfully captured in all infants. The mean (±SD) Edi minimum was 3.02 (±0.94) μV and the mean Edi peak was 10.13 (±3.50) μV. In preterm infants the mean (±SD) Edi minimum was 3.05 (±0.91) μV and the mean Edi peak was 9.36 (±2.13) μV. In term infants the mean (±SD) Edi minimum was 2.97 (±1.05) μV and the mean Edi peak was 11.66 (±5.14) μV. CONCLUSION: Reference Edi values were established for both preterm and term neonates. These values can be used as a guide when monitoring breathing support and when using diaphragm-triggered modes of respiratory support in newborn infants SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12887-022-03619-1.
format Online
Article
Text
id pubmed-9502911
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-95029112022-09-24 Reference values for diaphragm electrical activity (Edi) in newborn infants Gurumahan, Varappriyangga Thavalingam, Sriganesh Schindler, Tim Smyth, John Lui, Kei Bolisetty, Srinivas BMC Pediatr Research BACKGROUND: Neurally adjusted ventilatory assist is an emerging mode of respiratory support that uses the electrical activity of the diaphragm (Edi) to provide synchronised inspiratory pressure support, proportional to an infant’s changing inspiratory effort. Data on Edi reference values for neonates are limited. The objective of this study was to establish reference Edi values for preterm and term neonates who are not receiving respiratory support. METHODS: This was a prospective observational study of newborn infants breathing spontaneously in room air. The Edi waveform was monitored by a specialised naso/orogastric feeding tube with embedded electrodes positioned at the level of the diaphragm. Edi minimums and peaks were recorded continuously for 4 h without changes to routine clinical handling. RESULTS: Twenty-four newborn infants (16 preterm [< 37 weeks’ gestation]; 8 term) were studied. All infants were breathing comfortably in room air at the time of study. Edi data were successfully captured in all infants. The mean (±SD) Edi minimum was 3.02 (±0.94) μV and the mean Edi peak was 10.13 (±3.50) μV. In preterm infants the mean (±SD) Edi minimum was 3.05 (±0.91) μV and the mean Edi peak was 9.36 (±2.13) μV. In term infants the mean (±SD) Edi minimum was 2.97 (±1.05) μV and the mean Edi peak was 11.66 (±5.14) μV. CONCLUSION: Reference Edi values were established for both preterm and term neonates. These values can be used as a guide when monitoring breathing support and when using diaphragm-triggered modes of respiratory support in newborn infants SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12887-022-03619-1. BioMed Central 2022-09-23 /pmc/articles/PMC9502911/ /pubmed/36151518 http://dx.doi.org/10.1186/s12887-022-03619-1 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Gurumahan, Varappriyangga
Thavalingam, Sriganesh
Schindler, Tim
Smyth, John
Lui, Kei
Bolisetty, Srinivas
Reference values for diaphragm electrical activity (Edi) in newborn infants
title Reference values for diaphragm electrical activity (Edi) in newborn infants
title_full Reference values for diaphragm electrical activity (Edi) in newborn infants
title_fullStr Reference values for diaphragm electrical activity (Edi) in newborn infants
title_full_unstemmed Reference values for diaphragm electrical activity (Edi) in newborn infants
title_short Reference values for diaphragm electrical activity (Edi) in newborn infants
title_sort reference values for diaphragm electrical activity (edi) in newborn infants
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9502911/
https://www.ncbi.nlm.nih.gov/pubmed/36151518
http://dx.doi.org/10.1186/s12887-022-03619-1
work_keys_str_mv AT gurumahanvarappriyangga referencevaluesfordiaphragmelectricalactivityediinnewborninfants
AT thavalingamsriganesh referencevaluesfordiaphragmelectricalactivityediinnewborninfants
AT schindlertim referencevaluesfordiaphragmelectricalactivityediinnewborninfants
AT smythjohn referencevaluesfordiaphragmelectricalactivityediinnewborninfants
AT luikei referencevaluesfordiaphragmelectricalactivityediinnewborninfants
AT bolisettysrinivas referencevaluesfordiaphragmelectricalactivityediinnewborninfants