Cargando…
COVID-19 and the risk of CNS demyelinating diseases: A systematic review
BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the p...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9530047/ https://www.ncbi.nlm.nih.gov/pubmed/36203986 http://dx.doi.org/10.3389/fneur.2022.970383 |
_version_ | 1784801596900638720 |
---|---|
author | Lotan, Itay Nishiyama, Shuhei Manzano, Giovanna S. Lydston, Melissa Levy, Michael |
author_facet | Lotan, Itay Nishiyama, Shuhei Manzano, Giovanna S. Lydston, Melissa Levy, Michael |
author_sort | Lotan, Itay |
collection | PubMed |
description | BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the past 2 years, CNS demyelinating events associated with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection have been reported, but causality is unclear. OBJECTIVE: To investigate the relationship between CNS demyelinating disease development and exacerbation with antecedent and/or concurrent SARS-CoV-2 infection. METHODS: A systematic literature review of all publications describing either a new diagnosis or relapse of CNS demyelinating diseases (MS, NMOSD, MOGAD) in association with SARS-CoV-2 infection was performed utilizing PRISMA guidelines. Descriptive statistics were used for data analysis, using a case analysis approach. RESULTS: Sixty-seven articles met the inclusion criteria for the study. Most of the reported cases of NMOSD (n = 13, 72.2% of reported cases) and MOGAD (n = 27, 96.5% of reported cases) were of new disease onset, presenting with typical clinical and radiographic features of these conditions, respectively. In contrast, reported MS cases varied amongst newly diagnosed cases (n = 10, 10.5% of reported cases), relapses (n = 63, 66.4%) and pseudo-relapses (n = 22, 23.2%). The median duration between COVID-19 infection and demyelinating event onset was 11.5 days (range 0–90 days) in NMOSD, 6 days (range−7 to +45 days) in MOGAD, and 13.5 days (range−21 to +180 days) in MS. Most cases received high-dose corticosteroids with a good clinical outcome. CONCLUSION: Based upon available literature, the rate of CNS demyelinating events occurring in the setting of preceding or concurrent SARS-CoV-2 infection is relatively low considering the prevalence of SARS-CoV-2 infection. The clinical outcomes of new onset or relapsing MS, NMOSD, or MOGAD associated with antecedent or concurrent infection were mostly favorable. Larger prospective epidemiological studies are needed to better delineate the impact of COVID-19 on CNS demyelinating diseases. |
format | Online Article Text |
id | pubmed-9530047 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-95300472022-10-05 COVID-19 and the risk of CNS demyelinating diseases: A systematic review Lotan, Itay Nishiyama, Shuhei Manzano, Giovanna S. Lydston, Melissa Levy, Michael Front Neurol Neurology BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the past 2 years, CNS demyelinating events associated with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection have been reported, but causality is unclear. OBJECTIVE: To investigate the relationship between CNS demyelinating disease development and exacerbation with antecedent and/or concurrent SARS-CoV-2 infection. METHODS: A systematic literature review of all publications describing either a new diagnosis or relapse of CNS demyelinating diseases (MS, NMOSD, MOGAD) in association with SARS-CoV-2 infection was performed utilizing PRISMA guidelines. Descriptive statistics were used for data analysis, using a case analysis approach. RESULTS: Sixty-seven articles met the inclusion criteria for the study. Most of the reported cases of NMOSD (n = 13, 72.2% of reported cases) and MOGAD (n = 27, 96.5% of reported cases) were of new disease onset, presenting with typical clinical and radiographic features of these conditions, respectively. In contrast, reported MS cases varied amongst newly diagnosed cases (n = 10, 10.5% of reported cases), relapses (n = 63, 66.4%) and pseudo-relapses (n = 22, 23.2%). The median duration between COVID-19 infection and demyelinating event onset was 11.5 days (range 0–90 days) in NMOSD, 6 days (range−7 to +45 days) in MOGAD, and 13.5 days (range−21 to +180 days) in MS. Most cases received high-dose corticosteroids with a good clinical outcome. CONCLUSION: Based upon available literature, the rate of CNS demyelinating events occurring in the setting of preceding or concurrent SARS-CoV-2 infection is relatively low considering the prevalence of SARS-CoV-2 infection. The clinical outcomes of new onset or relapsing MS, NMOSD, or MOGAD associated with antecedent or concurrent infection were mostly favorable. Larger prospective epidemiological studies are needed to better delineate the impact of COVID-19 on CNS demyelinating diseases. Frontiers Media S.A. 2022-09-20 /pmc/articles/PMC9530047/ /pubmed/36203986 http://dx.doi.org/10.3389/fneur.2022.970383 Text en Copyright © 2022 Lotan, Nishiyama, Manzano, Lydston and Levy. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Neurology Lotan, Itay Nishiyama, Shuhei Manzano, Giovanna S. Lydston, Melissa Levy, Michael COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title | COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title_full | COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title_fullStr | COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title_full_unstemmed | COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title_short | COVID-19 and the risk of CNS demyelinating diseases: A systematic review |
title_sort | covid-19 and the risk of cns demyelinating diseases: a systematic review |
topic | Neurology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9530047/ https://www.ncbi.nlm.nih.gov/pubmed/36203986 http://dx.doi.org/10.3389/fneur.2022.970383 |
work_keys_str_mv | AT lotanitay covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview AT nishiyamashuhei covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview AT manzanogiovannas covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview AT lydstonmelissa covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview AT levymichael covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview |