Cargando…

COVID-19 and the risk of CNS demyelinating diseases: A systematic review

BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the p...

Descripción completa

Detalles Bibliográficos
Autores principales: Lotan, Itay, Nishiyama, Shuhei, Manzano, Giovanna S., Lydston, Melissa, Levy, Michael
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9530047/
https://www.ncbi.nlm.nih.gov/pubmed/36203986
http://dx.doi.org/10.3389/fneur.2022.970383
_version_ 1784801596900638720
author Lotan, Itay
Nishiyama, Shuhei
Manzano, Giovanna S.
Lydston, Melissa
Levy, Michael
author_facet Lotan, Itay
Nishiyama, Shuhei
Manzano, Giovanna S.
Lydston, Melissa
Levy, Michael
author_sort Lotan, Itay
collection PubMed
description BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the past 2 years, CNS demyelinating events associated with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection have been reported, but causality is unclear. OBJECTIVE: To investigate the relationship between CNS demyelinating disease development and exacerbation with antecedent and/or concurrent SARS-CoV-2 infection. METHODS: A systematic literature review of all publications describing either a new diagnosis or relapse of CNS demyelinating diseases (MS, NMOSD, MOGAD) in association with SARS-CoV-2 infection was performed utilizing PRISMA guidelines. Descriptive statistics were used for data analysis, using a case analysis approach. RESULTS: Sixty-seven articles met the inclusion criteria for the study. Most of the reported cases of NMOSD (n = 13, 72.2% of reported cases) and MOGAD (n = 27, 96.5% of reported cases) were of new disease onset, presenting with typical clinical and radiographic features of these conditions, respectively. In contrast, reported MS cases varied amongst newly diagnosed cases (n = 10, 10.5% of reported cases), relapses (n = 63, 66.4%) and pseudo-relapses (n = 22, 23.2%). The median duration between COVID-19 infection and demyelinating event onset was 11.5 days (range 0–90 days) in NMOSD, 6 days (range−7 to +45 days) in MOGAD, and 13.5 days (range−21 to +180 days) in MS. Most cases received high-dose corticosteroids with a good clinical outcome. CONCLUSION: Based upon available literature, the rate of CNS demyelinating events occurring in the setting of preceding or concurrent SARS-CoV-2 infection is relatively low considering the prevalence of SARS-CoV-2 infection. The clinical outcomes of new onset or relapsing MS, NMOSD, or MOGAD associated with antecedent or concurrent infection were mostly favorable. Larger prospective epidemiological studies are needed to better delineate the impact of COVID-19 on CNS demyelinating diseases.
format Online
Article
Text
id pubmed-9530047
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-95300472022-10-05 COVID-19 and the risk of CNS demyelinating diseases: A systematic review Lotan, Itay Nishiyama, Shuhei Manzano, Giovanna S. Lydston, Melissa Levy, Michael Front Neurol Neurology BACKGROUND: Viral infections are a proposed possible cause of inflammatory central nervous system (CNS) demyelinating diseases, including multiple sclerosis (MS), neuromyelitis optica spectrum disorder (NMOSD), and myelin oligodendrocyte glycoprotein antibody-associated disease (MOGAD). During the past 2 years, CNS demyelinating events associated with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection have been reported, but causality is unclear. OBJECTIVE: To investigate the relationship between CNS demyelinating disease development and exacerbation with antecedent and/or concurrent SARS-CoV-2 infection. METHODS: A systematic literature review of all publications describing either a new diagnosis or relapse of CNS demyelinating diseases (MS, NMOSD, MOGAD) in association with SARS-CoV-2 infection was performed utilizing PRISMA guidelines. Descriptive statistics were used for data analysis, using a case analysis approach. RESULTS: Sixty-seven articles met the inclusion criteria for the study. Most of the reported cases of NMOSD (n = 13, 72.2% of reported cases) and MOGAD (n = 27, 96.5% of reported cases) were of new disease onset, presenting with typical clinical and radiographic features of these conditions, respectively. In contrast, reported MS cases varied amongst newly diagnosed cases (n = 10, 10.5% of reported cases), relapses (n = 63, 66.4%) and pseudo-relapses (n = 22, 23.2%). The median duration between COVID-19 infection and demyelinating event onset was 11.5 days (range 0–90 days) in NMOSD, 6 days (range−7 to +45 days) in MOGAD, and 13.5 days (range−21 to +180 days) in MS. Most cases received high-dose corticosteroids with a good clinical outcome. CONCLUSION: Based upon available literature, the rate of CNS demyelinating events occurring in the setting of preceding or concurrent SARS-CoV-2 infection is relatively low considering the prevalence of SARS-CoV-2 infection. The clinical outcomes of new onset or relapsing MS, NMOSD, or MOGAD associated with antecedent or concurrent infection were mostly favorable. Larger prospective epidemiological studies are needed to better delineate the impact of COVID-19 on CNS demyelinating diseases. Frontiers Media S.A. 2022-09-20 /pmc/articles/PMC9530047/ /pubmed/36203986 http://dx.doi.org/10.3389/fneur.2022.970383 Text en Copyright © 2022 Lotan, Nishiyama, Manzano, Lydston and Levy. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Neurology
Lotan, Itay
Nishiyama, Shuhei
Manzano, Giovanna S.
Lydston, Melissa
Levy, Michael
COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title_full COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title_fullStr COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title_full_unstemmed COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title_short COVID-19 and the risk of CNS demyelinating diseases: A systematic review
title_sort covid-19 and the risk of cns demyelinating diseases: a systematic review
topic Neurology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9530047/
https://www.ncbi.nlm.nih.gov/pubmed/36203986
http://dx.doi.org/10.3389/fneur.2022.970383
work_keys_str_mv AT lotanitay covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview
AT nishiyamashuhei covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview
AT manzanogiovannas covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview
AT lydstonmelissa covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview
AT levymichael covid19andtheriskofcnsdemyelinatingdiseasesasystematicreview