Cargando…

The effect of basketball matches on salivary markers: a systematic review

The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre...

Descripción completa

Detalles Bibliográficos
Autores principales: Kamarauskas, Paulius, Conte, Daniele
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Institute of Sport in Warsaw 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9536388/
https://www.ncbi.nlm.nih.gov/pubmed/36247952
http://dx.doi.org/10.5114/biolsport.2022.107481
_version_ 1784802975063998464
author Kamarauskas, Paulius
Conte, Daniele
author_facet Kamarauskas, Paulius
Conte, Daniele
author_sort Kamarauskas, Paulius
collection PubMed
description The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre-defined selection criteria and a subsequent assessment of methodological quality was conducted. Articles matching the selection criteria and methodological quality were included in the systematic review. The electronic database search produced 696 articles. After removing 505 duplicates, 191 articles were included for screening. Screening led to 10 articles that met the inclusion criteria. The main findings revealed that playing a basketball match induced a highly stressful condition reflected by increased post-match cortisol levels regardless of season phase (i.e. regular vs. semi-final vs. final matches), match outcome (i.e. winning vs. losing matches) and location (i.e. home vs. away). Different results were found for testosterone, which showed inconsistent outcomes when measured before and after matches. However, an effect of match location on testosterone levels was observed, with higher concentrations before home matches compared to away matches. Finally, playing basketball matches led to an increase in levels of alpha-amylase, a decrease in interleukin-21 and no changes in immunoglobulin A, total protein and brain-derived-neurotrophic factor. The current results provide a detailed description of salivary markers changes in response to different basketball matches, which can help practitioners to have a better understanding of the basketball performance profile.
format Online
Article
Text
id pubmed-9536388
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Institute of Sport in Warsaw
record_format MEDLINE/PubMed
spelling pubmed-95363882022-10-14 The effect of basketball matches on salivary markers: a systematic review Kamarauskas, Paulius Conte, Daniele Biol Sport Review Paper The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre-defined selection criteria and a subsequent assessment of methodological quality was conducted. Articles matching the selection criteria and methodological quality were included in the systematic review. The electronic database search produced 696 articles. After removing 505 duplicates, 191 articles were included for screening. Screening led to 10 articles that met the inclusion criteria. The main findings revealed that playing a basketball match induced a highly stressful condition reflected by increased post-match cortisol levels regardless of season phase (i.e. regular vs. semi-final vs. final matches), match outcome (i.e. winning vs. losing matches) and location (i.e. home vs. away). Different results were found for testosterone, which showed inconsistent outcomes when measured before and after matches. However, an effect of match location on testosterone levels was observed, with higher concentrations before home matches compared to away matches. Finally, playing basketball matches led to an increase in levels of alpha-amylase, a decrease in interleukin-21 and no changes in immunoglobulin A, total protein and brain-derived-neurotrophic factor. The current results provide a detailed description of salivary markers changes in response to different basketball matches, which can help practitioners to have a better understanding of the basketball performance profile. Institute of Sport in Warsaw 2021-10-25 2022-10 /pmc/articles/PMC9536388/ /pubmed/36247952 http://dx.doi.org/10.5114/biolsport.2022.107481 Text en Copyright © Biology of Sport 2022 https://creativecommons.org/licenses/by-sa/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution Share Alike 4.0 License, allowing third parties to copy and redistribute the material in any medium or format and remix, transform, and build upon the material for any purpose, even commercially, provided the original work is properly cited and states its license.
spellingShingle Review Paper
Kamarauskas, Paulius
Conte, Daniele
The effect of basketball matches on salivary markers: a systematic review
title The effect of basketball matches on salivary markers: a systematic review
title_full The effect of basketball matches on salivary markers: a systematic review
title_fullStr The effect of basketball matches on salivary markers: a systematic review
title_full_unstemmed The effect of basketball matches on salivary markers: a systematic review
title_short The effect of basketball matches on salivary markers: a systematic review
title_sort effect of basketball matches on salivary markers: a systematic review
topic Review Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9536388/
https://www.ncbi.nlm.nih.gov/pubmed/36247952
http://dx.doi.org/10.5114/biolsport.2022.107481
work_keys_str_mv AT kamarauskaspaulius theeffectofbasketballmatchesonsalivarymarkersasystematicreview
AT contedaniele theeffectofbasketballmatchesonsalivarymarkersasystematicreview
AT kamarauskaspaulius effectofbasketballmatchesonsalivarymarkersasystematicreview
AT contedaniele effectofbasketballmatchesonsalivarymarkersasystematicreview