Cargando…
The effect of basketball matches on salivary markers: a systematic review
The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Institute of Sport in Warsaw
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9536388/ https://www.ncbi.nlm.nih.gov/pubmed/36247952 http://dx.doi.org/10.5114/biolsport.2022.107481 |
_version_ | 1784802975063998464 |
---|---|
author | Kamarauskas, Paulius Conte, Daniele |
author_facet | Kamarauskas, Paulius Conte, Daniele |
author_sort | Kamarauskas, Paulius |
collection | PubMed |
description | The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre-defined selection criteria and a subsequent assessment of methodological quality was conducted. Articles matching the selection criteria and methodological quality were included in the systematic review. The electronic database search produced 696 articles. After removing 505 duplicates, 191 articles were included for screening. Screening led to 10 articles that met the inclusion criteria. The main findings revealed that playing a basketball match induced a highly stressful condition reflected by increased post-match cortisol levels regardless of season phase (i.e. regular vs. semi-final vs. final matches), match outcome (i.e. winning vs. losing matches) and location (i.e. home vs. away). Different results were found for testosterone, which showed inconsistent outcomes when measured before and after matches. However, an effect of match location on testosterone levels was observed, with higher concentrations before home matches compared to away matches. Finally, playing basketball matches led to an increase in levels of alpha-amylase, a decrease in interleukin-21 and no changes in immunoglobulin A, total protein and brain-derived-neurotrophic factor. The current results provide a detailed description of salivary markers changes in response to different basketball matches, which can help practitioners to have a better understanding of the basketball performance profile. |
format | Online Article Text |
id | pubmed-9536388 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Institute of Sport in Warsaw |
record_format | MEDLINE/PubMed |
spelling | pubmed-95363882022-10-14 The effect of basketball matches on salivary markers: a systematic review Kamarauskas, Paulius Conte, Daniele Biol Sport Review Paper The aim of this paper was to synthesize the findings on salivary marker responses to the different basketball match typologies. An electronic database search of articles published until October 2020 was performed in PubMed, SPORTDiscus, Scopus and Web of Science. Studies were then screened using pre-defined selection criteria and a subsequent assessment of methodological quality was conducted. Articles matching the selection criteria and methodological quality were included in the systematic review. The electronic database search produced 696 articles. After removing 505 duplicates, 191 articles were included for screening. Screening led to 10 articles that met the inclusion criteria. The main findings revealed that playing a basketball match induced a highly stressful condition reflected by increased post-match cortisol levels regardless of season phase (i.e. regular vs. semi-final vs. final matches), match outcome (i.e. winning vs. losing matches) and location (i.e. home vs. away). Different results were found for testosterone, which showed inconsistent outcomes when measured before and after matches. However, an effect of match location on testosterone levels was observed, with higher concentrations before home matches compared to away matches. Finally, playing basketball matches led to an increase in levels of alpha-amylase, a decrease in interleukin-21 and no changes in immunoglobulin A, total protein and brain-derived-neurotrophic factor. The current results provide a detailed description of salivary markers changes in response to different basketball matches, which can help practitioners to have a better understanding of the basketball performance profile. Institute of Sport in Warsaw 2021-10-25 2022-10 /pmc/articles/PMC9536388/ /pubmed/36247952 http://dx.doi.org/10.5114/biolsport.2022.107481 Text en Copyright © Biology of Sport 2022 https://creativecommons.org/licenses/by-sa/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution Share Alike 4.0 License, allowing third parties to copy and redistribute the material in any medium or format and remix, transform, and build upon the material for any purpose, even commercially, provided the original work is properly cited and states its license. |
spellingShingle | Review Paper Kamarauskas, Paulius Conte, Daniele The effect of basketball matches on salivary markers: a systematic review |
title | The effect of basketball matches on salivary markers: a systematic review |
title_full | The effect of basketball matches on salivary markers: a systematic review |
title_fullStr | The effect of basketball matches on salivary markers: a systematic review |
title_full_unstemmed | The effect of basketball matches on salivary markers: a systematic review |
title_short | The effect of basketball matches on salivary markers: a systematic review |
title_sort | effect of basketball matches on salivary markers: a systematic review |
topic | Review Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9536388/ https://www.ncbi.nlm.nih.gov/pubmed/36247952 http://dx.doi.org/10.5114/biolsport.2022.107481 |
work_keys_str_mv | AT kamarauskaspaulius theeffectofbasketballmatchesonsalivarymarkersasystematicreview AT contedaniele theeffectofbasketballmatchesonsalivarymarkersasystematicreview AT kamarauskaspaulius effectofbasketballmatchesonsalivarymarkersasystematicreview AT contedaniele effectofbasketballmatchesonsalivarymarkersasystematicreview |