Cargando…

The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians

OBJECTIVE: Severe hypoglycemia is associated with increased cardiovascular death risk, and platelet responses to hypoglycemia (hypo) have been described. However, the impact of deep transient hypo (deep-hypo) versus prolonged milder hypo (mild-hypo) on platelet response is unclear. RESEARCH DESIGN A...

Descripción completa

Detalles Bibliográficos
Autores principales: Moin, Abu Saleh Md, Sathyapalan, Thozhukat, Atkin, Stephen L., Butler, Alexandra E.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9541052/
https://www.ncbi.nlm.nih.gov/pubmed/36203210
http://dx.doi.org/10.1186/s12933-022-01639-w
_version_ 1784803840423362560
author Moin, Abu Saleh Md
Sathyapalan, Thozhukat
Atkin, Stephen L.
Butler, Alexandra E.
author_facet Moin, Abu Saleh Md
Sathyapalan, Thozhukat
Atkin, Stephen L.
Butler, Alexandra E.
author_sort Moin, Abu Saleh Md
collection PubMed
description OBJECTIVE: Severe hypoglycemia is associated with increased cardiovascular death risk, and platelet responses to hypoglycemia (hypo) have been described. However, the impact of deep transient hypo (deep-hypo) versus prolonged milder hypo (mild-hypo) on platelet response is unclear. RESEARCH DESIGN AND METHODS: Two hypo studies were compared; firstly, mild-hypo in 18-subjects (10 type-2-diabetes (T2D), 8 controls), blood glucose to 2.8mmoL/L (50 mg/dL) for 1-hour; secondly deep-hypo in 46-subjects (23 T2D, 23 controls), blood glucose to < 2.2mmoL/L (< 40 mg/dL) transiently. Platelet-related protein (PRP) responses from baseline to after 1-hour of hypo (mild-hypo) or at deep-hypo were compared, and at 24-hours post-hypo. Slow Off-rate Modified Aptamer (SOMA)-scan plasma protein measurement was used to determine PRP changes for 13 PRPs. RESULTS: In controls, from baseline to hypo, differences were seen for four PRPs, three showing increased %change in deep-hypo (Plasminogen activator inhibitor-1(PAI-1), CD40 ligand (CD40LG) and Protein-S), one showing increased %change in mild-hypo (von Willebrand factor (vWF)); at 24-hours in controls, %change for Protein-S remained increased in deep-hypo, whilst % change for vWF and plasminogen were increased in mild-hypo. In T2D, from baseline to hypo, differences were seen for 4 PRPs, three showing increased %change in deep-hypo (PAI-1, platelet glycoprotein VI and Tissue factor), one showing increased %change in mild-hypo (CD40LG); at 24-hours in T2D, %change for CD40LG remained increased, together with vWF, in deep-hypo. CONCLUSION: Both mild-hypo and deep-hypo showed marked PRP changes that continued up to 24-hours, showing that both the severity and duration of hypoglycemia are likely important and that any degree of hypoglycemia may be detrimental for increased cardiovascular risk events through PRP changes. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12933-022-01639-w.
format Online
Article
Text
id pubmed-9541052
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-95410522022-10-08 The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians Moin, Abu Saleh Md Sathyapalan, Thozhukat Atkin, Stephen L. Butler, Alexandra E. Cardiovasc Diabetol Research OBJECTIVE: Severe hypoglycemia is associated with increased cardiovascular death risk, and platelet responses to hypoglycemia (hypo) have been described. However, the impact of deep transient hypo (deep-hypo) versus prolonged milder hypo (mild-hypo) on platelet response is unclear. RESEARCH DESIGN AND METHODS: Two hypo studies were compared; firstly, mild-hypo in 18-subjects (10 type-2-diabetes (T2D), 8 controls), blood glucose to 2.8mmoL/L (50 mg/dL) for 1-hour; secondly deep-hypo in 46-subjects (23 T2D, 23 controls), blood glucose to < 2.2mmoL/L (< 40 mg/dL) transiently. Platelet-related protein (PRP) responses from baseline to after 1-hour of hypo (mild-hypo) or at deep-hypo were compared, and at 24-hours post-hypo. Slow Off-rate Modified Aptamer (SOMA)-scan plasma protein measurement was used to determine PRP changes for 13 PRPs. RESULTS: In controls, from baseline to hypo, differences were seen for four PRPs, three showing increased %change in deep-hypo (Plasminogen activator inhibitor-1(PAI-1), CD40 ligand (CD40LG) and Protein-S), one showing increased %change in mild-hypo (von Willebrand factor (vWF)); at 24-hours in controls, %change for Protein-S remained increased in deep-hypo, whilst % change for vWF and plasminogen were increased in mild-hypo. In T2D, from baseline to hypo, differences were seen for 4 PRPs, three showing increased %change in deep-hypo (PAI-1, platelet glycoprotein VI and Tissue factor), one showing increased %change in mild-hypo (CD40LG); at 24-hours in T2D, %change for CD40LG remained increased, together with vWF, in deep-hypo. CONCLUSION: Both mild-hypo and deep-hypo showed marked PRP changes that continued up to 24-hours, showing that both the severity and duration of hypoglycemia are likely important and that any degree of hypoglycemia may be detrimental for increased cardiovascular risk events through PRP changes. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12933-022-01639-w. BioMed Central 2022-10-06 /pmc/articles/PMC9541052/ /pubmed/36203210 http://dx.doi.org/10.1186/s12933-022-01639-w Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Moin, Abu Saleh Md
Sathyapalan, Thozhukat
Atkin, Stephen L.
Butler, Alexandra E.
The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title_full The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title_fullStr The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title_full_unstemmed The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title_short The severity and duration of Hypoglycemia affect platelet-derived protein responses in Caucasians
title_sort severity and duration of hypoglycemia affect platelet-derived protein responses in caucasians
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9541052/
https://www.ncbi.nlm.nih.gov/pubmed/36203210
http://dx.doi.org/10.1186/s12933-022-01639-w
work_keys_str_mv AT moinabusalehmd theseverityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT sathyapalanthozhukat theseverityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT atkinstephenl theseverityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT butleralexandrae theseverityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT moinabusalehmd severityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT sathyapalanthozhukat severityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT atkinstephenl severityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians
AT butleralexandrae severityanddurationofhypoglycemiaaffectplateletderivedproteinresponsesincaucasians