Cargando…

Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions

OBJECTIVES: To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementati...

Descripción completa

Detalles Bibliográficos
Autores principales: Brima, Nataliya, Morhason-Bello, Imran O, Charles, Vandy, Davies, Justine, Leather, Andy JM
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BMJ Publishing Group 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9557325/
https://www.ncbi.nlm.nih.gov/pubmed/36220318
http://dx.doi.org/10.1136/bmjopen-2022-062616
_version_ 1784807279718039552
author Brima, Nataliya
Morhason-Bello, Imran O
Charles, Vandy
Davies, Justine
Leather, Andy JM
author_facet Brima, Nataliya
Morhason-Bello, Imran O
Charles, Vandy
Davies, Justine
Leather, Andy JM
author_sort Brima, Nataliya
collection PubMed
description OBJECTIVES: To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementation learning. DESIGN: We conducted a systematic literature review and narrative synthesis. SETTING: Literature on hospital-based quality improvement studies in sub-Saharan Africa reviewed until 31 December 2021. PARTICIPANTS: MEDLINE, EMBASE, Global Health, CINAHL, Web of Science databases and grey literature were searched. INTERVENTION: We extracted data on intervention characteristics and how the intervention was delivered and evaluated. PRIMARY AND SECONDARY OUTCOME MEASURES: Importantly, we assessed whether clinical, process and implementation outcomes were collected and separately categorised the outcomes under the Institute of Medicine quality domains. Risk of bias was not assessed. RESULTS: Of 1573 articles identified, 49 were included from 17/48 sub-Saharan African countries, 16 of which were low-income or lower middle-income countries. Almost two-thirds of the studies took place in East Africa (31/49, 63.2%). The most common intervention focus was reduction of surgical site infection (12/49, 24.5%) and use of a surgical safety checklist (14/49, 28.6%). Use of implementation and quality improvement science methods were rare. Over half the studies measured clinical outcomes (29/49, 59.2%), with the most commonly reported ones being perioperative mortality (13/29, 44.8%) and surgical site infection rate (14/29, 48.3%). Process and implementation outcomes were reported in over two thirds of the studies (34/49, 69.4% and 35, 71.4%, respectively). The most studied quality domain was safety (44/49, 89.8%), with efficiency (4/49, 8.2%) and equitability (2/49, 4.1%) the least studied domains. CONCLUSIONS: There are few hospital-based studies that focus on improving the quality of surgical and anaesthesia care in sub-Saharan Africa. Use of implementation and quality improvement methodologies remain low, and some quality domains are neglected. PROSPERO REGISTRATION NUMBER: CRD42019125570
format Online
Article
Text
id pubmed-9557325
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BMJ Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-95573252022-10-14 Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions Brima, Nataliya Morhason-Bello, Imran O Charles, Vandy Davies, Justine Leather, Andy JM BMJ Open Global Health OBJECTIVES: To systematically review existing literature on hospital-based quality improvement studies in sub-Saharan Africa that aim to improve surgical and anaesthesia care, capturing clinical, process and implementation outcomes in order to evaluate the impact of the intervention and implementation learning. DESIGN: We conducted a systematic literature review and narrative synthesis. SETTING: Literature on hospital-based quality improvement studies in sub-Saharan Africa reviewed until 31 December 2021. PARTICIPANTS: MEDLINE, EMBASE, Global Health, CINAHL, Web of Science databases and grey literature were searched. INTERVENTION: We extracted data on intervention characteristics and how the intervention was delivered and evaluated. PRIMARY AND SECONDARY OUTCOME MEASURES: Importantly, we assessed whether clinical, process and implementation outcomes were collected and separately categorised the outcomes under the Institute of Medicine quality domains. Risk of bias was not assessed. RESULTS: Of 1573 articles identified, 49 were included from 17/48 sub-Saharan African countries, 16 of which were low-income or lower middle-income countries. Almost two-thirds of the studies took place in East Africa (31/49, 63.2%). The most common intervention focus was reduction of surgical site infection (12/49, 24.5%) and use of a surgical safety checklist (14/49, 28.6%). Use of implementation and quality improvement science methods were rare. Over half the studies measured clinical outcomes (29/49, 59.2%), with the most commonly reported ones being perioperative mortality (13/29, 44.8%) and surgical site infection rate (14/29, 48.3%). Process and implementation outcomes were reported in over two thirds of the studies (34/49, 69.4% and 35, 71.4%, respectively). The most studied quality domain was safety (44/49, 89.8%), with efficiency (4/49, 8.2%) and equitability (2/49, 4.1%) the least studied domains. CONCLUSIONS: There are few hospital-based studies that focus on improving the quality of surgical and anaesthesia care in sub-Saharan Africa. Use of implementation and quality improvement methodologies remain low, and some quality domains are neglected. PROSPERO REGISTRATION NUMBER: CRD42019125570 BMJ Publishing Group 2022-10-11 /pmc/articles/PMC9557325/ /pubmed/36220318 http://dx.doi.org/10.1136/bmjopen-2022-062616 Text en © Author(s) (or their employer(s)) 2022. Re-use permitted under CC BY-NC. No commercial re-use. See rights and permissions. Published by BMJ. https://creativecommons.org/licenses/by-nc/4.0/This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, appropriate credit is given, any changes made indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) .
spellingShingle Global Health
Brima, Nataliya
Morhason-Bello, Imran O
Charles, Vandy
Davies, Justine
Leather, Andy JM
Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title_full Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title_fullStr Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title_full_unstemmed Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title_short Improving quality of surgical and anaesthesia care in sub-Saharan Africa: a systematic review of hospital-based quality improvement interventions
title_sort improving quality of surgical and anaesthesia care in sub-saharan africa: a systematic review of hospital-based quality improvement interventions
topic Global Health
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9557325/
https://www.ncbi.nlm.nih.gov/pubmed/36220318
http://dx.doi.org/10.1136/bmjopen-2022-062616
work_keys_str_mv AT brimanataliya improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions
AT morhasonbelloimrano improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions
AT charlesvandy improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions
AT daviesjustine improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions
AT leatherandyjm improvingqualityofsurgicalandanaesthesiacareinsubsaharanafricaasystematicreviewofhospitalbasedqualityimprovementinterventions