Cargando…

Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review

Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant prot...

Descripción completa

Detalles Bibliográficos
Autores principales: Tarar, Muhammad Yasir, Khalid, Aizaz, Choo, Xin Yin, Khurshid, Sadaf, Tumeh, Haitham, Muhammad, Karim
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cureus 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9573790/
https://www.ncbi.nlm.nih.gov/pubmed/36262941
http://dx.doi.org/10.7759/cureus.29243
_version_ 1784810959420784640
author Tarar, Muhammad Yasir
Khalid, Aizaz
Choo, Xin Yin
Khurshid, Sadaf
Tumeh, Haitham
Muhammad, Karim
author_facet Tarar, Muhammad Yasir
Khalid, Aizaz
Choo, Xin Yin
Khurshid, Sadaf
Tumeh, Haitham
Muhammad, Karim
author_sort Tarar, Muhammad Yasir
collection PubMed
description Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant protein, C-reactive protein (CRP), and an abundant circulating protein in plasma, albumin, in daily practice, this study aimed to assess the ratio of CRP and albumin for assessing the severity of acute pancreatitis. A systematic review of the literature was performed using the keywords CRP albumin ratio and acute pancreatitis in the PubMed and Cochrane databases. Studies reporting the use of the ratio of CRP and albumin in acute pancreatitis as well as the outcomes were included in this analysis. The quality of studies was assessed using the MINORS (methodological index for non-randomized studies) assessment tool. In our review, across these three studies, 956 patients with acute pancreatitis were identified and enrolled in studies that examined the relationship between the CRP/Albumin ratio and the severity of acute pancreatitis. Overall, a positive correlation was found between the CRP/albumin ratio at admission and the development of subsequent severe acute pancreatitis, increased hospital length of stay, and the higher rate of mortality in these studies.
format Online
Article
Text
id pubmed-9573790
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Cureus
record_format MEDLINE/PubMed
spelling pubmed-95737902022-10-18 Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review Tarar, Muhammad Yasir Khalid, Aizaz Choo, Xin Yin Khurshid, Sadaf Tumeh, Haitham Muhammad, Karim Cureus General Surgery Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant protein, C-reactive protein (CRP), and an abundant circulating protein in plasma, albumin, in daily practice, this study aimed to assess the ratio of CRP and albumin for assessing the severity of acute pancreatitis. A systematic review of the literature was performed using the keywords CRP albumin ratio and acute pancreatitis in the PubMed and Cochrane databases. Studies reporting the use of the ratio of CRP and albumin in acute pancreatitis as well as the outcomes were included in this analysis. The quality of studies was assessed using the MINORS (methodological index for non-randomized studies) assessment tool. In our review, across these three studies, 956 patients with acute pancreatitis were identified and enrolled in studies that examined the relationship between the CRP/Albumin ratio and the severity of acute pancreatitis. Overall, a positive correlation was found between the CRP/albumin ratio at admission and the development of subsequent severe acute pancreatitis, increased hospital length of stay, and the higher rate of mortality in these studies. Cureus 2022-09-16 /pmc/articles/PMC9573790/ /pubmed/36262941 http://dx.doi.org/10.7759/cureus.29243 Text en Copyright © 2022, Tarar et al. https://creativecommons.org/licenses/by/3.0/This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle General Surgery
Tarar, Muhammad Yasir
Khalid, Aizaz
Choo, Xin Yin
Khurshid, Sadaf
Tumeh, Haitham
Muhammad, Karim
Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title_full Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title_fullStr Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title_full_unstemmed Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title_short Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
title_sort use of the c-reactive protein (crp)/albumin ratio as a severity tool in acute pancreatitis: systematic review
topic General Surgery
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9573790/
https://www.ncbi.nlm.nih.gov/pubmed/36262941
http://dx.doi.org/10.7759/cureus.29243
work_keys_str_mv AT tararmuhammadyasir useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview
AT khalidaizaz useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview
AT chooxinyin useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview
AT khurshidsadaf useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview
AT tumehhaitham useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview
AT muhammadkarim useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview