Cargando…
Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review
Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant prot...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cureus
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9573790/ https://www.ncbi.nlm.nih.gov/pubmed/36262941 http://dx.doi.org/10.7759/cureus.29243 |
_version_ | 1784810959420784640 |
---|---|
author | Tarar, Muhammad Yasir Khalid, Aizaz Choo, Xin Yin Khurshid, Sadaf Tumeh, Haitham Muhammad, Karim |
author_facet | Tarar, Muhammad Yasir Khalid, Aizaz Choo, Xin Yin Khurshid, Sadaf Tumeh, Haitham Muhammad, Karim |
author_sort | Tarar, Muhammad Yasir |
collection | PubMed |
description | Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant protein, C-reactive protein (CRP), and an abundant circulating protein in plasma, albumin, in daily practice, this study aimed to assess the ratio of CRP and albumin for assessing the severity of acute pancreatitis. A systematic review of the literature was performed using the keywords CRP albumin ratio and acute pancreatitis in the PubMed and Cochrane databases. Studies reporting the use of the ratio of CRP and albumin in acute pancreatitis as well as the outcomes were included in this analysis. The quality of studies was assessed using the MINORS (methodological index for non-randomized studies) assessment tool. In our review, across these three studies, 956 patients with acute pancreatitis were identified and enrolled in studies that examined the relationship between the CRP/Albumin ratio and the severity of acute pancreatitis. Overall, a positive correlation was found between the CRP/albumin ratio at admission and the development of subsequent severe acute pancreatitis, increased hospital length of stay, and the higher rate of mortality in these studies. |
format | Online Article Text |
id | pubmed-9573790 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Cureus |
record_format | MEDLINE/PubMed |
spelling | pubmed-95737902022-10-18 Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review Tarar, Muhammad Yasir Khalid, Aizaz Choo, Xin Yin Khurshid, Sadaf Tumeh, Haitham Muhammad, Karim Cureus General Surgery Acute pancreatitis is one of the most common conditions with high rates of morbidity and mortality. Different scoring systems are used to gauge the severity of this condition, which, in turn, estimates the complications and mortality rates. With the ever-evolving use of the acute-phase reactant protein, C-reactive protein (CRP), and an abundant circulating protein in plasma, albumin, in daily practice, this study aimed to assess the ratio of CRP and albumin for assessing the severity of acute pancreatitis. A systematic review of the literature was performed using the keywords CRP albumin ratio and acute pancreatitis in the PubMed and Cochrane databases. Studies reporting the use of the ratio of CRP and albumin in acute pancreatitis as well as the outcomes were included in this analysis. The quality of studies was assessed using the MINORS (methodological index for non-randomized studies) assessment tool. In our review, across these three studies, 956 patients with acute pancreatitis were identified and enrolled in studies that examined the relationship between the CRP/Albumin ratio and the severity of acute pancreatitis. Overall, a positive correlation was found between the CRP/albumin ratio at admission and the development of subsequent severe acute pancreatitis, increased hospital length of stay, and the higher rate of mortality in these studies. Cureus 2022-09-16 /pmc/articles/PMC9573790/ /pubmed/36262941 http://dx.doi.org/10.7759/cureus.29243 Text en Copyright © 2022, Tarar et al. https://creativecommons.org/licenses/by/3.0/This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | General Surgery Tarar, Muhammad Yasir Khalid, Aizaz Choo, Xin Yin Khurshid, Sadaf Tumeh, Haitham Muhammad, Karim Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title | Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title_full | Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title_fullStr | Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title_full_unstemmed | Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title_short | Use of the C-Reactive Protein (CRP)/Albumin Ratio as a Severity Tool in Acute Pancreatitis: Systematic Review |
title_sort | use of the c-reactive protein (crp)/albumin ratio as a severity tool in acute pancreatitis: systematic review |
topic | General Surgery |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9573790/ https://www.ncbi.nlm.nih.gov/pubmed/36262941 http://dx.doi.org/10.7759/cureus.29243 |
work_keys_str_mv | AT tararmuhammadyasir useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview AT khalidaizaz useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview AT chooxinyin useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview AT khurshidsadaf useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview AT tumehhaitham useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview AT muhammadkarim useofthecreactiveproteincrpalbuminratioasaseveritytoolinacutepancreatitissystematicreview |