Cargando…
Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase
The objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO(4) vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9584640/ https://www.ncbi.nlm.nih.gov/pubmed/36277189 http://dx.doi.org/10.3389/fphys.2022.992689 |
_version_ | 1784813314496266240 |
---|---|
author | De Grande, Annatachja Ducatelle, Richard Leleu, Saskia Rapp, Christof Torres, Cibele Petracci, Massimiliano De Smet, Stefaan Michiels, Joris Haesebrouck, Freddy Van Immerseel, Filip Delezie, Evelyne |
author_facet | De Grande, Annatachja Ducatelle, Richard Leleu, Saskia Rapp, Christof Torres, Cibele Petracci, Massimiliano De Smet, Stefaan Michiels, Joris Haesebrouck, Freddy Van Immerseel, Filip Delezie, Evelyne |
author_sort | De Grande, Annatachja |
collection | PubMed |
description | The objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO(4) vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day-old male Ross 308 broilers were randomly distributed among four dietary treatments. Each treatment contained nine replicates of 34 birds, housed in floor pens in a temperature- and lighting-controlled room. Treatments were organized in a 2 × 2 factorial arrangement: two sources of zinc, 60 mg/kg of Zn as ZnSO(4) or 60 mg/kg of Zn as zinc amino acid complexes (ZnAA), combined with two levels of vitamin E (50 or 100 IU/kg). From day 28 until day 37 (finisher phase), all birds were subjected to chronic cyclic heat stress (32 ± 2°C for 6 h daily). In the present study, it was observed that replacing ZnSO(4) with ZnAA increased breast meat weight and yield of broilers reared under chronic cyclic heat stress conditions, whereas total slaughter yield was not affected. Moreover, it was observed that replacing ZnSO(4) with ZnAA resulted in breast meat with a lower drip and thawing loss and a higher marinade uptake. In conclusion, replacing ZnSO(4) with more readily available ZnAA can improve breast meat yield and increase the water-holding capacity of breast meat of broilers exposed to chronic cyclic heat stress at the end of the production cycle. However, as no thermoneutral group was included in the present study, the observed effects of the zinc source cannot be generalized as a solution for heat stress. Moreover, the beneficial effects of ZnAA on breast meat yield and quality seem to be independent of the vitamin E level, and increasing vitamin E level has no additional beneficial effects. |
format | Online Article Text |
id | pubmed-9584640 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-95846402022-10-21 Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase De Grande, Annatachja Ducatelle, Richard Leleu, Saskia Rapp, Christof Torres, Cibele Petracci, Massimiliano De Smet, Stefaan Michiels, Joris Haesebrouck, Freddy Van Immerseel, Filip Delezie, Evelyne Front Physiol Physiology The objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO(4) vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day-old male Ross 308 broilers were randomly distributed among four dietary treatments. Each treatment contained nine replicates of 34 birds, housed in floor pens in a temperature- and lighting-controlled room. Treatments were organized in a 2 × 2 factorial arrangement: two sources of zinc, 60 mg/kg of Zn as ZnSO(4) or 60 mg/kg of Zn as zinc amino acid complexes (ZnAA), combined with two levels of vitamin E (50 or 100 IU/kg). From day 28 until day 37 (finisher phase), all birds were subjected to chronic cyclic heat stress (32 ± 2°C for 6 h daily). In the present study, it was observed that replacing ZnSO(4) with ZnAA increased breast meat weight and yield of broilers reared under chronic cyclic heat stress conditions, whereas total slaughter yield was not affected. Moreover, it was observed that replacing ZnSO(4) with ZnAA resulted in breast meat with a lower drip and thawing loss and a higher marinade uptake. In conclusion, replacing ZnSO(4) with more readily available ZnAA can improve breast meat yield and increase the water-holding capacity of breast meat of broilers exposed to chronic cyclic heat stress at the end of the production cycle. However, as no thermoneutral group was included in the present study, the observed effects of the zinc source cannot be generalized as a solution for heat stress. Moreover, the beneficial effects of ZnAA on breast meat yield and quality seem to be independent of the vitamin E level, and increasing vitamin E level has no additional beneficial effects. Frontiers Media S.A. 2022-10-06 /pmc/articles/PMC9584640/ /pubmed/36277189 http://dx.doi.org/10.3389/fphys.2022.992689 Text en Copyright © 2022 De Grande, Ducatelle, Leleu, Rapp, Torres, Petracci, De Smet, Michiels, Haesebrouck, Van Immerseel and Delezie. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Physiology De Grande, Annatachja Ducatelle, Richard Leleu, Saskia Rapp, Christof Torres, Cibele Petracci, Massimiliano De Smet, Stefaan Michiels, Joris Haesebrouck, Freddy Van Immerseel, Filip Delezie, Evelyne Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title_full | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title_fullStr | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title_full_unstemmed | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title_short | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
title_sort | effects of the dietary zinc source and vitamin e level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
topic | Physiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9584640/ https://www.ncbi.nlm.nih.gov/pubmed/36277189 http://dx.doi.org/10.3389/fphys.2022.992689 |
work_keys_str_mv | AT degrandeannatachja effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT ducatellerichard effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT leleusaskia effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT rappchristof effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT torrescibele effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT petraccimassimiliano effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT desmetstefaan effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT michielsjoris effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT haesebrouckfreddy effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT vanimmerseelfilip effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT delezieevelyne effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase |