Cargando…

Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI

Layer-specific cortical microcircuits have been explored through invasive animal studies, yet it is not possible to reliably characterize them functionally and noninvasively in the human brain. However, recent advances in ultra-high-field functional magnetic resonance imaging (fMRI) have made it fea...

Descripción completa

Detalles Bibliográficos
Autores principales: Deshpande, Gopikrishna, Wang, Yun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9599333/
https://www.ncbi.nlm.nih.gov/pubmed/36291295
http://dx.doi.org/10.3390/brainsci12101361
_version_ 1784816568499175424
author Deshpande, Gopikrishna
Wang, Yun
author_facet Deshpande, Gopikrishna
Wang, Yun
author_sort Deshpande, Gopikrishna
collection PubMed
description Layer-specific cortical microcircuits have been explored through invasive animal studies, yet it is not possible to reliably characterize them functionally and noninvasively in the human brain. However, recent advances in ultra-high-field functional magnetic resonance imaging (fMRI) have made it feasible to reasonably resolve layer-specific fMRI signals with sub-millimeter resolution. Here, we propose an experimental and analytical framework that enables the noninvasive functional characterization of layer-specific cortical microcircuits. Specifically, we illustrate this framework by characterizing layer-specific functional pathways in the corticogeniculate network of the human visual system by obtaining sub-millimeter fMRI at 7T using a task which engages the magnocellular pathway between the lateral geniculate nucleus (LGN) and the primary visual cortex. Our results demonstrate that: (i) center-surround inhibition in magnocellular neurons within LGN is detectable using localized fMRI responses; (ii) feedforward (LGN → layers VI/IV, layer IV → layer VI) and feedback (layer VI → LGN) functional pathways, known to exist from invasive animal studies, can be inferred using dynamic directional connectivity models of fMRI and could potentially explain the mechanism underlying center-surround inhibition as well as gain control by layer VI in the human visual system. Our framework is domain-neutral and could potentially be employed to investigate the layer-specific cortical microcircuits in other systems related to cognition, memory and language.
format Online
Article
Text
id pubmed-9599333
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-95993332022-10-27 Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI Deshpande, Gopikrishna Wang, Yun Brain Sci Article Layer-specific cortical microcircuits have been explored through invasive animal studies, yet it is not possible to reliably characterize them functionally and noninvasively in the human brain. However, recent advances in ultra-high-field functional magnetic resonance imaging (fMRI) have made it feasible to reasonably resolve layer-specific fMRI signals with sub-millimeter resolution. Here, we propose an experimental and analytical framework that enables the noninvasive functional characterization of layer-specific cortical microcircuits. Specifically, we illustrate this framework by characterizing layer-specific functional pathways in the corticogeniculate network of the human visual system by obtaining sub-millimeter fMRI at 7T using a task which engages the magnocellular pathway between the lateral geniculate nucleus (LGN) and the primary visual cortex. Our results demonstrate that: (i) center-surround inhibition in magnocellular neurons within LGN is detectable using localized fMRI responses; (ii) feedforward (LGN → layers VI/IV, layer IV → layer VI) and feedback (layer VI → LGN) functional pathways, known to exist from invasive animal studies, can be inferred using dynamic directional connectivity models of fMRI and could potentially explain the mechanism underlying center-surround inhibition as well as gain control by layer VI in the human visual system. Our framework is domain-neutral and could potentially be employed to investigate the layer-specific cortical microcircuits in other systems related to cognition, memory and language. MDPI 2022-10-07 /pmc/articles/PMC9599333/ /pubmed/36291295 http://dx.doi.org/10.3390/brainsci12101361 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Deshpande, Gopikrishna
Wang, Yun
Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title_full Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title_fullStr Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title_full_unstemmed Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title_short Noninvasive Characterization of Functional Pathways in Layer-Specific Microcircuits of the Human Brain Using 7T fMRI
title_sort noninvasive characterization of functional pathways in layer-specific microcircuits of the human brain using 7t fmri
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9599333/
https://www.ncbi.nlm.nih.gov/pubmed/36291295
http://dx.doi.org/10.3390/brainsci12101361
work_keys_str_mv AT deshpandegopikrishna noninvasivecharacterizationoffunctionalpathwaysinlayerspecificmicrocircuitsofthehumanbrainusing7tfmri
AT wangyun noninvasivecharacterizationoffunctionalpathwaysinlayerspecificmicrocircuitsofthehumanbrainusing7tfmri