Cargando…
The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in morta...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9607122/ https://www.ncbi.nlm.nih.gov/pubmed/36287975 http://dx.doi.org/10.3390/toxins14100707 |
_version_ | 1784818463050563584 |
---|---|
author | Kolawole, Oluwatobi Siri-Anusornsak, Wipada Petchkongkaw, Awanwee Meneely, Julie Elliott, Christopher |
author_facet | Kolawole, Oluwatobi Siri-Anusornsak, Wipada Petchkongkaw, Awanwee Meneely, Julie Elliott, Christopher |
author_sort | Kolawole, Oluwatobi |
collection | PubMed |
description | The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in mortality, feed waste, and increased production costs. They can also be excreted in milk and thus pose a significant human health risk. This systematic review and network meta-analysis aim to compare and identify the most effective intervention to alleviate the negative impact of aflatoxins on the important livestock sector, poultry production. Eligible studies on the efficacy of feed additives to mitigate the toxic effect of aflatoxins in poultry were retrieved from different databases. Additives were classified into three categories based on their mode of action and composition: organic binder, inorganic binder, and antioxidant. Moreover, alanine transaminase (ALT), a liver enzyme, was the primary indicator. Supplementing aflatoxin-contaminated feeds with different categories of additives significantly reduces serum ALT levels (p < 0.001) compared with birds fed only a contaminated diet. Inorganic binder (P-score 0.8615) was ranked to be the most efficient in terms of counteracting the toxic effect of aflatoxins, followed by antioxidant (P-score 0.6159) and organic binder (P-score 0.5018). These findings will have significant importance for farmers, veterinarians, and animal nutrition companies when deciding which type of additives to use for mitigating exposure to aflatoxins, thus improving food security and the livelihoods of smallholder farmers in developing countries. |
format | Online Article Text |
id | pubmed-9607122 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-96071222022-10-28 The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis Kolawole, Oluwatobi Siri-Anusornsak, Wipada Petchkongkaw, Awanwee Meneely, Julie Elliott, Christopher Toxins (Basel) Review The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in mortality, feed waste, and increased production costs. They can also be excreted in milk and thus pose a significant human health risk. This systematic review and network meta-analysis aim to compare and identify the most effective intervention to alleviate the negative impact of aflatoxins on the important livestock sector, poultry production. Eligible studies on the efficacy of feed additives to mitigate the toxic effect of aflatoxins in poultry were retrieved from different databases. Additives were classified into three categories based on their mode of action and composition: organic binder, inorganic binder, and antioxidant. Moreover, alanine transaminase (ALT), a liver enzyme, was the primary indicator. Supplementing aflatoxin-contaminated feeds with different categories of additives significantly reduces serum ALT levels (p < 0.001) compared with birds fed only a contaminated diet. Inorganic binder (P-score 0.8615) was ranked to be the most efficient in terms of counteracting the toxic effect of aflatoxins, followed by antioxidant (P-score 0.6159) and organic binder (P-score 0.5018). These findings will have significant importance for farmers, veterinarians, and animal nutrition companies when deciding which type of additives to use for mitigating exposure to aflatoxins, thus improving food security and the livelihoods of smallholder farmers in developing countries. MDPI 2022-10-15 /pmc/articles/PMC9607122/ /pubmed/36287975 http://dx.doi.org/10.3390/toxins14100707 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Kolawole, Oluwatobi Siri-Anusornsak, Wipada Petchkongkaw, Awanwee Meneely, Julie Elliott, Christopher The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title | The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title_full | The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title_fullStr | The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title_full_unstemmed | The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title_short | The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis |
title_sort | efficacy of additives for the mitigation of aflatoxins in animal feed: a systematic review and network meta-analysis |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9607122/ https://www.ncbi.nlm.nih.gov/pubmed/36287975 http://dx.doi.org/10.3390/toxins14100707 |
work_keys_str_mv | AT kolawoleoluwatobi theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT sirianusornsakwipada theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT petchkongkawawanwee theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT meneelyjulie theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT elliottchristopher theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT kolawoleoluwatobi efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT sirianusornsakwipada efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT petchkongkawawanwee efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT meneelyjulie efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis AT elliottchristopher efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis |