Cargando…

The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis

The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in morta...

Descripción completa

Detalles Bibliográficos
Autores principales: Kolawole, Oluwatobi, Siri-Anusornsak, Wipada, Petchkongkaw, Awanwee, Meneely, Julie, Elliott, Christopher
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9607122/
https://www.ncbi.nlm.nih.gov/pubmed/36287975
http://dx.doi.org/10.3390/toxins14100707
_version_ 1784818463050563584
author Kolawole, Oluwatobi
Siri-Anusornsak, Wipada
Petchkongkaw, Awanwee
Meneely, Julie
Elliott, Christopher
author_facet Kolawole, Oluwatobi
Siri-Anusornsak, Wipada
Petchkongkaw, Awanwee
Meneely, Julie
Elliott, Christopher
author_sort Kolawole, Oluwatobi
collection PubMed
description The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in mortality, feed waste, and increased production costs. They can also be excreted in milk and thus pose a significant human health risk. This systematic review and network meta-analysis aim to compare and identify the most effective intervention to alleviate the negative impact of aflatoxins on the important livestock sector, poultry production. Eligible studies on the efficacy of feed additives to mitigate the toxic effect of aflatoxins in poultry were retrieved from different databases. Additives were classified into three categories based on their mode of action and composition: organic binder, inorganic binder, and antioxidant. Moreover, alanine transaminase (ALT), a liver enzyme, was the primary indicator. Supplementing aflatoxin-contaminated feeds with different categories of additives significantly reduces serum ALT levels (p < 0.001) compared with birds fed only a contaminated diet. Inorganic binder (P-score 0.8615) was ranked to be the most efficient in terms of counteracting the toxic effect of aflatoxins, followed by antioxidant (P-score 0.6159) and organic binder (P-score 0.5018). These findings will have significant importance for farmers, veterinarians, and animal nutrition companies when deciding which type of additives to use for mitigating exposure to aflatoxins, thus improving food security and the livelihoods of smallholder farmers in developing countries.
format Online
Article
Text
id pubmed-9607122
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-96071222022-10-28 The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis Kolawole, Oluwatobi Siri-Anusornsak, Wipada Petchkongkaw, Awanwee Meneely, Julie Elliott, Christopher Toxins (Basel) Review The contamination of animal feed with aflatoxins is an ongoing and growing serious issue, particularly for livestock farmers in tropical and subtropical regions. Exposure of animals to an aflatoxin-contaminated diet impairs feed efficiency and increases susceptibility to diseases, resulting in mortality, feed waste, and increased production costs. They can also be excreted in milk and thus pose a significant human health risk. This systematic review and network meta-analysis aim to compare and identify the most effective intervention to alleviate the negative impact of aflatoxins on the important livestock sector, poultry production. Eligible studies on the efficacy of feed additives to mitigate the toxic effect of aflatoxins in poultry were retrieved from different databases. Additives were classified into three categories based on their mode of action and composition: organic binder, inorganic binder, and antioxidant. Moreover, alanine transaminase (ALT), a liver enzyme, was the primary indicator. Supplementing aflatoxin-contaminated feeds with different categories of additives significantly reduces serum ALT levels (p < 0.001) compared with birds fed only a contaminated diet. Inorganic binder (P-score 0.8615) was ranked to be the most efficient in terms of counteracting the toxic effect of aflatoxins, followed by antioxidant (P-score 0.6159) and organic binder (P-score 0.5018). These findings will have significant importance for farmers, veterinarians, and animal nutrition companies when deciding which type of additives to use for mitigating exposure to aflatoxins, thus improving food security and the livelihoods of smallholder farmers in developing countries. MDPI 2022-10-15 /pmc/articles/PMC9607122/ /pubmed/36287975 http://dx.doi.org/10.3390/toxins14100707 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Kolawole, Oluwatobi
Siri-Anusornsak, Wipada
Petchkongkaw, Awanwee
Meneely, Julie
Elliott, Christopher
The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title_full The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title_fullStr The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title_full_unstemmed The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title_short The Efficacy of Additives for the Mitigation of Aflatoxins in Animal Feed: A Systematic Review and Network Meta-Analysis
title_sort efficacy of additives for the mitigation of aflatoxins in animal feed: a systematic review and network meta-analysis
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9607122/
https://www.ncbi.nlm.nih.gov/pubmed/36287975
http://dx.doi.org/10.3390/toxins14100707
work_keys_str_mv AT kolawoleoluwatobi theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT sirianusornsakwipada theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT petchkongkawawanwee theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT meneelyjulie theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT elliottchristopher theefficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT kolawoleoluwatobi efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT sirianusornsakwipada efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT petchkongkawawanwee efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT meneelyjulie efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis
AT elliottchristopher efficacyofadditivesforthemitigationofaflatoxinsinanimalfeedasystematicreviewandnetworkmetaanalysis