Cargando…

ODP452 A Case of Thymic Hyperplasia in Graves’ Disease

INTRODUCTION: We report a case of a patient with Graves’ Disease (GD) associated with thymic hyperplasia (TH) which regressed with treatment of GD. The association between these two conditions is under recognized. The causative mechanisms between TH associated with GD are still under investigation....

Descripción completa

Detalles Bibliográficos
Autores principales: Ahmed, Ammar, Buckley, Lisa, Maradana, Jhansi, Nuvvula, Sri, Tan, Zi, Thompson, Michael J, Zainal, Abir
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9625800/
http://dx.doi.org/10.1210/jendso/bvac150.1555
_version_ 1784822591810174976
author Ahmed, Ammar
Buckley, Lisa
Maradana, Jhansi
Nuvvula, Sri
Tan, Zi
Thompson, Michael J
Zainal, Abir
author_facet Ahmed, Ammar
Buckley, Lisa
Maradana, Jhansi
Nuvvula, Sri
Tan, Zi
Thompson, Michael J
Zainal, Abir
author_sort Ahmed, Ammar
collection PubMed
description INTRODUCTION: We report a case of a patient with Graves’ Disease (GD) associated with thymic hyperplasia (TH) which regressed with treatment of GD. The association between these two conditions is under recognized. The causative mechanisms between TH associated with GD are still under investigation. CASE DESCRIPTION: A 39-year-old male patient presented with hemoptysis, dyspnea, palpitations, tremors and unintentional weight loss. His TSH was suppressed to < 0. 005 and free T4 was elevated to 5.51. As part of his work up a CT scan was performed which revealed a prominent anterior mediastinal mass. He was started on Methimazole and Atenolol. Lab work confirming positive TSI and TRAB antibodies consistent with Graves’ disease. At follow up, he opted for radioactive iodine ablation therapy with 20mCi. He had failure of therapy and was resumed on Methimazole. He ultimately underwent total thyroidectomy with subsequent thyroid hormone replacement with Levothyroxine 150mcg daily. His thyroid function tests normalized, and his symptoms resolved. A repeat CT thorax was performed which showed complete resolution of his mediastinal mass, consistent with GD associated TH. CONCLUSIONS: GD associated TH was first described in 1914. Data supports TSH receptor antibody mediated thymic enlargement1. TH can be classified in two morphological types, lymphoid hyperplasia unassociated with thymic enlargement and true TH in which an increase in thymic volume is evident 2. Thymic cortical tissue expansion seems to be due to a hyperthyroid state involving increased levels of thymulin, a protein involved in lymphocyte differentiation whereas lymphoid hyperplasia correlates with the immune process in GD 2. Antithyroid drug therapy reduces circulating thyroid hormone levels causing a generalized immunosuppressive effect. This reduces hyperplasia of lymphatic organs including the thymus 3. There are no current guidelines for the management and surveillance of thymic hyperplasia in GD as the course and timeline of regression of TH can vary widely. Thymic biopsies are performed frequently to rule out malignancy, however, it is important to raise awareness that GD associated TH has a benign course and generally resolves with management of the underlying GD 3. It is imperative to avoid unnecessary invasive procedures and their subsequent complications in such GD patients. References: 1] Dalla Costa M (2014) Thymic hyperplasia in patients with Graves’ disease. J Endocrinol invest 37: 1175-1179. 2] Nakamura S (2012) Thymic enlargement in two cases of Graves’ disease. Internal Med 51: 673-674.3] Nakamura T et al (2004) A case of thymic enlargement in hyperthyroidism in a young woman. Thyroid 14: 307-310. Presentation: No date and time listed
format Online
Article
Text
id pubmed-9625800
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-96258002022-11-14 ODP452 A Case of Thymic Hyperplasia in Graves’ Disease Ahmed, Ammar Buckley, Lisa Maradana, Jhansi Nuvvula, Sri Tan, Zi Thompson, Michael J Zainal, Abir J Endocr Soc Thyroid INTRODUCTION: We report a case of a patient with Graves’ Disease (GD) associated with thymic hyperplasia (TH) which regressed with treatment of GD. The association between these two conditions is under recognized. The causative mechanisms between TH associated with GD are still under investigation. CASE DESCRIPTION: A 39-year-old male patient presented with hemoptysis, dyspnea, palpitations, tremors and unintentional weight loss. His TSH was suppressed to < 0. 005 and free T4 was elevated to 5.51. As part of his work up a CT scan was performed which revealed a prominent anterior mediastinal mass. He was started on Methimazole and Atenolol. Lab work confirming positive TSI and TRAB antibodies consistent with Graves’ disease. At follow up, he opted for radioactive iodine ablation therapy with 20mCi. He had failure of therapy and was resumed on Methimazole. He ultimately underwent total thyroidectomy with subsequent thyroid hormone replacement with Levothyroxine 150mcg daily. His thyroid function tests normalized, and his symptoms resolved. A repeat CT thorax was performed which showed complete resolution of his mediastinal mass, consistent with GD associated TH. CONCLUSIONS: GD associated TH was first described in 1914. Data supports TSH receptor antibody mediated thymic enlargement1. TH can be classified in two morphological types, lymphoid hyperplasia unassociated with thymic enlargement and true TH in which an increase in thymic volume is evident 2. Thymic cortical tissue expansion seems to be due to a hyperthyroid state involving increased levels of thymulin, a protein involved in lymphocyte differentiation whereas lymphoid hyperplasia correlates with the immune process in GD 2. Antithyroid drug therapy reduces circulating thyroid hormone levels causing a generalized immunosuppressive effect. This reduces hyperplasia of lymphatic organs including the thymus 3. There are no current guidelines for the management and surveillance of thymic hyperplasia in GD as the course and timeline of regression of TH can vary widely. Thymic biopsies are performed frequently to rule out malignancy, however, it is important to raise awareness that GD associated TH has a benign course and generally resolves with management of the underlying GD 3. It is imperative to avoid unnecessary invasive procedures and their subsequent complications in such GD patients. References: 1] Dalla Costa M (2014) Thymic hyperplasia in patients with Graves’ disease. J Endocrinol invest 37: 1175-1179. 2] Nakamura S (2012) Thymic enlargement in two cases of Graves’ disease. Internal Med 51: 673-674.3] Nakamura T et al (2004) A case of thymic enlargement in hyperthyroidism in a young woman. Thyroid 14: 307-310. Presentation: No date and time listed Oxford University Press 2022-11-01 /pmc/articles/PMC9625800/ http://dx.doi.org/10.1210/jendso/bvac150.1555 Text en © The Author(s) 2022. Published by Oxford University Press on behalf of the Endocrine Society. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs licence (https://creativecommons.org/licenses/by-nc-nd/4.0/), which permits non-commercial reproduction and distribution of the work, in any medium, provided the original work is not altered or transformed in any way, and that the work is properly cited. For commercial re-use, please contact journals.permissions@oup.com
spellingShingle Thyroid
Ahmed, Ammar
Buckley, Lisa
Maradana, Jhansi
Nuvvula, Sri
Tan, Zi
Thompson, Michael J
Zainal, Abir
ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title_full ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title_fullStr ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title_full_unstemmed ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title_short ODP452 A Case of Thymic Hyperplasia in Graves’ Disease
title_sort odp452 a case of thymic hyperplasia in graves’ disease
topic Thyroid
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9625800/
http://dx.doi.org/10.1210/jendso/bvac150.1555
work_keys_str_mv AT ahmedammar odp452acaseofthymichyperplasiaingravesdisease
AT buckleylisa odp452acaseofthymichyperplasiaingravesdisease
AT maradanajhansi odp452acaseofthymichyperplasiaingravesdisease
AT nuvvulasri odp452acaseofthymichyperplasiaingravesdisease
AT tanzi odp452acaseofthymichyperplasiaingravesdisease
AT thompsonmichaelj odp452acaseofthymichyperplasiaingravesdisease
AT zainalabir odp452acaseofthymichyperplasiaingravesdisease