Cargando…
Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics
Intramuscular injection of anemoside B4 (AB4) has a superior therapeutic effect on clinical mastitis in lactating cows. Here, we explored AB4’s effect on milk whey in clinical mastitis-affected cows using proteomics. Among fifty clinical mastitis cows received AB4 administration (0.05 ml/kg/day, for...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9637092/ https://www.ncbi.nlm.nih.gov/pubmed/36335251 http://dx.doi.org/10.1038/s41598-022-23749-x |
_version_ | 1784825100221022208 |
---|---|
author | Shen, Liu-hong Zhang, Yue Shen, Yu Su, Zhe-tong Yu, Shu-min Cao, Sui-zhong Zong, Xiao-lan |
author_facet | Shen, Liu-hong Zhang, Yue Shen, Yu Su, Zhe-tong Yu, Shu-min Cao, Sui-zhong Zong, Xiao-lan |
author_sort | Shen, Liu-hong |
collection | PubMed |
description | Intramuscular injection of anemoside B4 (AB4) has a superior therapeutic effect on clinical mastitis in lactating cows. Here, we explored AB4’s effect on milk whey in clinical mastitis-affected cows using proteomics. Among fifty clinical mastitis cows received AB4 administration (0.05 ml/kg/day, for 7 days), twelve healed cows were selected and marked as group T. Twelve clinically heathy cows received the same dose of saline for 7 days, marked as group C. Collected milk whey of group T before and after AB4 administration marked as T1 and T2, respectively. The milk whey of group C after saline injection marked as C1. Milk whey protein changes were detected using tandem mass tag-based quantitative proteomic. We identified 872 quantifiable proteins in the samples. Among them, 511 proteins between T1 and C1, and 361 proteins between T2 and T1 were significantly altered. T1 than C1 had significantly more proteins associated with inflammatory damage and trans-endothelial migration of leukocytes, whereas these proteins were reduced in T2 treated with AB4. Compared with C, proteins associated with fibrin clot degradation and complement system activation were downregulated in T1 but upregulated in T2. In summary, AB4 can exert its therapeutic effect on clinical mastitis in cows mainly by reducing inflammatory damage, activating the complement system, inhibiting trans-endothelial migration of leukocytes, and promoting degradation of milk fibrin clots. |
format | Online Article Text |
id | pubmed-9637092 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-96370922022-11-07 Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics Shen, Liu-hong Zhang, Yue Shen, Yu Su, Zhe-tong Yu, Shu-min Cao, Sui-zhong Zong, Xiao-lan Sci Rep Article Intramuscular injection of anemoside B4 (AB4) has a superior therapeutic effect on clinical mastitis in lactating cows. Here, we explored AB4’s effect on milk whey in clinical mastitis-affected cows using proteomics. Among fifty clinical mastitis cows received AB4 administration (0.05 ml/kg/day, for 7 days), twelve healed cows were selected and marked as group T. Twelve clinically heathy cows received the same dose of saline for 7 days, marked as group C. Collected milk whey of group T before and after AB4 administration marked as T1 and T2, respectively. The milk whey of group C after saline injection marked as C1. Milk whey protein changes were detected using tandem mass tag-based quantitative proteomic. We identified 872 quantifiable proteins in the samples. Among them, 511 proteins between T1 and C1, and 361 proteins between T2 and T1 were significantly altered. T1 than C1 had significantly more proteins associated with inflammatory damage and trans-endothelial migration of leukocytes, whereas these proteins were reduced in T2 treated with AB4. Compared with C, proteins associated with fibrin clot degradation and complement system activation were downregulated in T1 but upregulated in T2. In summary, AB4 can exert its therapeutic effect on clinical mastitis in cows mainly by reducing inflammatory damage, activating the complement system, inhibiting trans-endothelial migration of leukocytes, and promoting degradation of milk fibrin clots. Nature Publishing Group UK 2022-11-05 /pmc/articles/PMC9637092/ /pubmed/36335251 http://dx.doi.org/10.1038/s41598-022-23749-x Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Shen, Liu-hong Zhang, Yue Shen, Yu Su, Zhe-tong Yu, Shu-min Cao, Sui-zhong Zong, Xiao-lan Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title | Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title_full | Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title_fullStr | Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title_full_unstemmed | Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title_short | Effect of anemoside B4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (TMT)-based quantitative proteomics |
title_sort | effect of anemoside b4 on milk whey in clinical mastitis-affected cows elucidated using tandem mass tag (tmt)-based quantitative proteomics |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9637092/ https://www.ncbi.nlm.nih.gov/pubmed/36335251 http://dx.doi.org/10.1038/s41598-022-23749-x |
work_keys_str_mv | AT shenliuhong effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT zhangyue effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT shenyu effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT suzhetong effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT yushumin effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT caosuizhong effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics AT zongxiaolan effectofanemosideb4onmilkwheyinclinicalmastitisaffectedcowselucidatedusingtandemmasstagtmtbasedquantitativeproteomics |