Cargando…
The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review
BACKGROUND: Preclinical studies have shown a therapeutic role of the mechanistic/mammalian target of rapamycin complex 1 (mTORC1) inhibition with rapamycin and its analogues (rapalogues) on several age-related musculoskeletal disorders (MSKD). However, the applicability to humans of these findings i...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer International Publishing
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9637607/ https://www.ncbi.nlm.nih.gov/pubmed/35861940 http://dx.doi.org/10.1007/s40520-022-02190-0 |
_version_ | 1784825224156413952 |
---|---|
author | Lin, Hong Salech, Felipe Lim, Anthony Vogrin, Sara Duque, Gustavo |
author_facet | Lin, Hong Salech, Felipe Lim, Anthony Vogrin, Sara Duque, Gustavo |
author_sort | Lin, Hong |
collection | PubMed |
description | BACKGROUND: Preclinical studies have shown a therapeutic role of the mechanistic/mammalian target of rapamycin complex 1 (mTORC1) inhibition with rapamycin and its analogues (rapalogues) on several age-related musculoskeletal disorders (MSKD). However, the applicability to humans of these findings is unknown. OBJECTIVE: To assess the efficacy of rapalogues on age-related MSKD in humans. METHODS: We conducted a systematic review according to the PRISMA guidelines. MEDLINE, EMBase, EMCare, and Cochrane Central Registry of Controlled Trials were searched for original studies examining the effects of rapalogues on outcomes linked to the age-related MSKD in humans. This review is registered in the PROSPERO database (University of New York; registration number CRD42020208167). RESULTS: Fourteen studies met the inclusion criteria and were analyzed. The effect of rapamycin and other rapalogues, including everolimus and temsirolimus, on bone, muscle and joints have been evaluated in humans; however, considerable variability concerning the subjects’ age, inclusion criteria, and drug administration protocols was identified. In bone, the use of rapamycin is associated with a decrease in bone resorption markers dependent on osteoclastic activity. In muscle, rapamycin and rapalogues are associated with a reduction in muscle protein synthesis in response to exercise. In the context of rheumatoid arthritis, rapamycin and rapalogues have been associated with clinical improvement and a decrease in inflammatory activity. CONCLUSION: Although there are studies that have evaluated the effect of rapamycin and rapalogues on MSKD in humans, the evidence supporting its use is still incipient, and the clinical implication of these results on the development of osteoporosis, sarcopenia, or osteosarcopenia has not been studied, opening an interesting field for future research. |
format | Online Article Text |
id | pubmed-9637607 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Springer International Publishing |
record_format | MEDLINE/PubMed |
spelling | pubmed-96376072022-11-08 The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review Lin, Hong Salech, Felipe Lim, Anthony Vogrin, Sara Duque, Gustavo Aging Clin Exp Res Review Article BACKGROUND: Preclinical studies have shown a therapeutic role of the mechanistic/mammalian target of rapamycin complex 1 (mTORC1) inhibition with rapamycin and its analogues (rapalogues) on several age-related musculoskeletal disorders (MSKD). However, the applicability to humans of these findings is unknown. OBJECTIVE: To assess the efficacy of rapalogues on age-related MSKD in humans. METHODS: We conducted a systematic review according to the PRISMA guidelines. MEDLINE, EMBase, EMCare, and Cochrane Central Registry of Controlled Trials were searched for original studies examining the effects of rapalogues on outcomes linked to the age-related MSKD in humans. This review is registered in the PROSPERO database (University of New York; registration number CRD42020208167). RESULTS: Fourteen studies met the inclusion criteria and were analyzed. The effect of rapamycin and other rapalogues, including everolimus and temsirolimus, on bone, muscle and joints have been evaluated in humans; however, considerable variability concerning the subjects’ age, inclusion criteria, and drug administration protocols was identified. In bone, the use of rapamycin is associated with a decrease in bone resorption markers dependent on osteoclastic activity. In muscle, rapamycin and rapalogues are associated with a reduction in muscle protein synthesis in response to exercise. In the context of rheumatoid arthritis, rapamycin and rapalogues have been associated with clinical improvement and a decrease in inflammatory activity. CONCLUSION: Although there are studies that have evaluated the effect of rapamycin and rapalogues on MSKD in humans, the evidence supporting its use is still incipient, and the clinical implication of these results on the development of osteoporosis, sarcopenia, or osteosarcopenia has not been studied, opening an interesting field for future research. Springer International Publishing 2022-07-21 2022 /pmc/articles/PMC9637607/ /pubmed/35861940 http://dx.doi.org/10.1007/s40520-022-02190-0 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Review Article Lin, Hong Salech, Felipe Lim, Anthony Vogrin, Sara Duque, Gustavo The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title | The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title_full | The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title_fullStr | The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title_full_unstemmed | The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title_short | The effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
title_sort | effect of rapamycin and its analogues on age-related musculoskeletal diseases: a systematic review |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9637607/ https://www.ncbi.nlm.nih.gov/pubmed/35861940 http://dx.doi.org/10.1007/s40520-022-02190-0 |
work_keys_str_mv | AT linhong theeffectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT salechfelipe theeffectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT limanthony theeffectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT vogrinsara theeffectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT duquegustavo theeffectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT linhong effectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT salechfelipe effectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT limanthony effectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT vogrinsara effectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview AT duquegustavo effectofrapamycinanditsanaloguesonagerelatedmusculoskeletaldiseasesasystematicreview |