Cargando…
SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma
Thyroid cancer is the most common form of endocrine cancer around the world, and among which papillary thyroid carcinoma (PTC) is the most ubiquitous pathological sub-kind. Sushi repeat-containing protein X-linked 2 (SRPX2) was reported to be an independent prognostic factor and significantly overex...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9649326/ https://www.ncbi.nlm.nih.gov/pubmed/36385962 http://dx.doi.org/10.1155/2022/5821545 |
_version_ | 1784827772429926400 |
---|---|
author | Luo, Ning Tan, Yanfei Deng, Hong Wu, Weiling Mei, Lang Huang, Xinping Qin, Yu Zhu, Hongbo Liu, Chang |
author_facet | Luo, Ning Tan, Yanfei Deng, Hong Wu, Weiling Mei, Lang Huang, Xinping Qin, Yu Zhu, Hongbo Liu, Chang |
author_sort | Luo, Ning |
collection | PubMed |
description | Thyroid cancer is the most common form of endocrine cancer around the world, and among which papillary thyroid carcinoma (PTC) is the most ubiquitous pathological sub-kind. Sushi repeat-containing protein X-linked 2 (SRPX2) was reported to be an independent prognostic factor and significantly overexpressed in advanced PTC patients. However, the biological functions of SRPX2 remain ambiguous in PTC. Here, we explored SRPX2 expression profiles and functions in PTC, finding that SRPX2 expression was remarkably upregulated in PTC tissues and cell lines. Further colony formation, CCK-8, as well as transwell assay, suggested that SRPX2 silencing remarkably dampened PTC growth and migration. Mouse xenograft models were established to find that SRPX2 silence remarkably suppressed PTC proliferation and migration in vivo. Following mechanism studies revealed that SRPX2 realized its functions in the PTC process partially through activating the Focal adhesion kinase (FAK) phosphorylation. In conclusion, this study investigated the functions and mechanisms of the SRPX2/FAK pathway in PTC progression. SRPX2 could act as a prospective biologic signature and therapeutic target molecule for PTC. |
format | Online Article Text |
id | pubmed-9649326 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-96493262022-11-15 SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma Luo, Ning Tan, Yanfei Deng, Hong Wu, Weiling Mei, Lang Huang, Xinping Qin, Yu Zhu, Hongbo Liu, Chang J Oncol Research Article Thyroid cancer is the most common form of endocrine cancer around the world, and among which papillary thyroid carcinoma (PTC) is the most ubiquitous pathological sub-kind. Sushi repeat-containing protein X-linked 2 (SRPX2) was reported to be an independent prognostic factor and significantly overexpressed in advanced PTC patients. However, the biological functions of SRPX2 remain ambiguous in PTC. Here, we explored SRPX2 expression profiles and functions in PTC, finding that SRPX2 expression was remarkably upregulated in PTC tissues and cell lines. Further colony formation, CCK-8, as well as transwell assay, suggested that SRPX2 silencing remarkably dampened PTC growth and migration. Mouse xenograft models were established to find that SRPX2 silence remarkably suppressed PTC proliferation and migration in vivo. Following mechanism studies revealed that SRPX2 realized its functions in the PTC process partially through activating the Focal adhesion kinase (FAK) phosphorylation. In conclusion, this study investigated the functions and mechanisms of the SRPX2/FAK pathway in PTC progression. SRPX2 could act as a prospective biologic signature and therapeutic target molecule for PTC. Hindawi 2022-11-03 /pmc/articles/PMC9649326/ /pubmed/36385962 http://dx.doi.org/10.1155/2022/5821545 Text en Copyright © 2022 Ning Luo et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Luo, Ning Tan, Yanfei Deng, Hong Wu, Weiling Mei, Lang Huang, Xinping Qin, Yu Zhu, Hongbo Liu, Chang SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title | SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title_full | SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title_fullStr | SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title_full_unstemmed | SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title_short | SRPX2 Promotes Tumor Proliferation and Migration via the FAK Pathway in Papillary Thyroid Carcinoma |
title_sort | srpx2 promotes tumor proliferation and migration via the fak pathway in papillary thyroid carcinoma |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9649326/ https://www.ncbi.nlm.nih.gov/pubmed/36385962 http://dx.doi.org/10.1155/2022/5821545 |
work_keys_str_mv | AT luoning srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT tanyanfei srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT denghong srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT wuweiling srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT meilang srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT huangxinping srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT qinyu srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT zhuhongbo srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma AT liuchang srpx2promotestumorproliferationandmigrationviathefakpathwayinpapillarythyroidcarcinoma |