Cargando…

Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident

BACKGROUND: Cerebrovascular accident (CVA) and Parkinson’s disease (PD) are well established etiologies of dysphagia. However, differing physiological mechanisms underlying dysphagia may exist between these two causes. There have been limited investigations specifically comparing dysphagia between t...

Descripción completa

Detalles Bibliográficos
Autores principales: Dumican, Matthew, Watts, Christopher
Formato: Online Artículo Texto
Lenguaje:English
Publicado: IOS Press 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9661323/
https://www.ncbi.nlm.nih.gov/pubmed/36120789
http://dx.doi.org/10.3233/JPD-223272
_version_ 1784830452004028416
author Dumican, Matthew
Watts, Christopher
author_facet Dumican, Matthew
Watts, Christopher
author_sort Dumican, Matthew
collection PubMed
description BACKGROUND: Cerebrovascular accident (CVA) and Parkinson’s disease (PD) are well established etiologies of dysphagia. However, differing physiological mechanisms underlying dysphagia may exist between these two causes. There have been limited investigations specifically comparing dysphagia between these two groups. Comparing dysphagia presentation in two different populations may improve clinical expectations, guide treatment approaches, and inform future research. OBJECTIVE: This study examined the differences in presentation of dysphagia between PD and CVA. Dysphagia presentation, swallow safety, and laryngeal kinematics were compared between two clinical cohorts. What factors best predicted airway invasion in each group were explored. METHODS: 110 swallow studies of individuals with PD and CVA who were referred for swallowing evaluation were obtained. Each video was analyzed for quantitative dysphagia presentation using the Videofluoroscopic Dysphagia Scale (VDS), swallow safety using the Penetration-Aspiration scale, and kinematic timings of the laryngeal vestibule (time-to-laryngeal vestibule closure [LVC] and closure duration [LVCd]). RESULTS: Frequencies of penetration or aspiration were similar between groups. The PD group displayed significantly greater pharyngeal stage swallow impairment than CVA, with more frequent reduced laryngeal elevation and increased vallecular residue. The CVA group displayed significantly greater oral stage impairment, with prolonged oral transit times. Time-to-LVC was significantly prolonged and was the strongest predictor of airway invasion in the PD group, but not for CVA. CONCLUSION: Similar airway invasion rates for PD and CVA indicate the importance of screening for dysphagia in PD. Laryngeal kinematics as significant contributors to airway invasion in PD but not for CVA highlight the need for further research into these mechanisms and for targeted treatment approaches to dysphagia.
format Online
Article
Text
id pubmed-9661323
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher IOS Press
record_format MEDLINE/PubMed
spelling pubmed-96613232022-11-28 Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident Dumican, Matthew Watts, Christopher J Parkinsons Dis Research Report BACKGROUND: Cerebrovascular accident (CVA) and Parkinson’s disease (PD) are well established etiologies of dysphagia. However, differing physiological mechanisms underlying dysphagia may exist between these two causes. There have been limited investigations specifically comparing dysphagia between these two groups. Comparing dysphagia presentation in two different populations may improve clinical expectations, guide treatment approaches, and inform future research. OBJECTIVE: This study examined the differences in presentation of dysphagia between PD and CVA. Dysphagia presentation, swallow safety, and laryngeal kinematics were compared between two clinical cohorts. What factors best predicted airway invasion in each group were explored. METHODS: 110 swallow studies of individuals with PD and CVA who were referred for swallowing evaluation were obtained. Each video was analyzed for quantitative dysphagia presentation using the Videofluoroscopic Dysphagia Scale (VDS), swallow safety using the Penetration-Aspiration scale, and kinematic timings of the laryngeal vestibule (time-to-laryngeal vestibule closure [LVC] and closure duration [LVCd]). RESULTS: Frequencies of penetration or aspiration were similar between groups. The PD group displayed significantly greater pharyngeal stage swallow impairment than CVA, with more frequent reduced laryngeal elevation and increased vallecular residue. The CVA group displayed significantly greater oral stage impairment, with prolonged oral transit times. Time-to-LVC was significantly prolonged and was the strongest predictor of airway invasion in the PD group, but not for CVA. CONCLUSION: Similar airway invasion rates for PD and CVA indicate the importance of screening for dysphagia in PD. Laryngeal kinematics as significant contributors to airway invasion in PD but not for CVA highlight the need for further research into these mechanisms and for targeted treatment approaches to dysphagia. IOS Press 2022-10-14 /pmc/articles/PMC9661323/ /pubmed/36120789 http://dx.doi.org/10.3233/JPD-223272 Text en © 2022 – The authors. Published by IOS Press https://creativecommons.org/licenses/by-nc/4.0/This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial (CC BY-NC 4.0) License (https://creativecommons.org/licenses/by-nc/4.0/) , which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Report
Dumican, Matthew
Watts, Christopher
Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title_full Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title_fullStr Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title_full_unstemmed Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title_short Swallow Safety and Laryngeal Kinematics: A Comparison of Dysphagia Between Parkinson’s Disease and Cerebrovascular Accident
title_sort swallow safety and laryngeal kinematics: a comparison of dysphagia between parkinson’s disease and cerebrovascular accident
topic Research Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9661323/
https://www.ncbi.nlm.nih.gov/pubmed/36120789
http://dx.doi.org/10.3233/JPD-223272
work_keys_str_mv AT dumicanmatthew swallowsafetyandlaryngealkinematicsacomparisonofdysphagiabetweenparkinsonsdiseaseandcerebrovascularaccident
AT wattschristopher swallowsafetyandlaryngealkinematicsacomparisonofdysphagiabetweenparkinsonsdiseaseandcerebrovascularaccident