Cargando…

A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy

Radiotherapy (RT) for head and neck cancer results in irreversible damage to salivary glands (SGs) and decreases saliva production, leading to a dry mouth. To date, there are no satisfactory therapies to solve this problem. We recently established a novel culturing method using a Rho kinase inhibito...

Descripción completa

Detalles Bibliográficos
Autores principales: Kasamatsu, Atsushi, Fukushima, Reo, Nakamura, Koki, Kawasaki, Kohei, Yoshimura, Shusaku, Koyama, Tomoyoshi, Fukumoto, Chonji, Miyamoto, Isao, Uzawa, Katsuhiro
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9663336/
https://www.ncbi.nlm.nih.gov/pubmed/36386443
http://dx.doi.org/10.1016/j.bbrep.2022.101385
_version_ 1784830851279749120
author Kasamatsu, Atsushi
Fukushima, Reo
Nakamura, Koki
Kawasaki, Kohei
Yoshimura, Shusaku
Koyama, Tomoyoshi
Fukumoto, Chonji
Miyamoto, Isao
Uzawa, Katsuhiro
author_facet Kasamatsu, Atsushi
Fukushima, Reo
Nakamura, Koki
Kawasaki, Kohei
Yoshimura, Shusaku
Koyama, Tomoyoshi
Fukumoto, Chonji
Miyamoto, Isao
Uzawa, Katsuhiro
author_sort Kasamatsu, Atsushi
collection PubMed
description Radiotherapy (RT) for head and neck cancer results in irreversible damage to salivary glands (SGs) and decreases saliva production, leading to a dry mouth. To date, there are no satisfactory therapies to solve this problem. We recently established a novel culturing method using a Rho kinase inhibitor (RI), Y-27632, that maintained cellular morphology and function for a prolonged period of time. In the present study, we investigated whether cell-based transplantation using our culturing method ameliorated the dysfunction of irradiated SGs. First, rat SG cells were cultured in a medium with RI. Cells were characterized by morphological findings and mRNA expression analysis. We also assessed features of SG cells in three-dimensional (3-D) culture by scanning electron microscopy and immunohistochemistry (IHC). The RI-containing medium led to higher cell proliferation of rat SG cells with preservation of cell morphology and higher alpha-amylase (AMY) expression in both 2-D and 3-D culture systems. To establish the atrophic-SG models, external RT at a dose of 15 Gy was delivered to the head and neck fields of nude rats. The SG cells derived from GFP-rats were cultured in medium with RI, after which they were transplanted into the submandibular glands of atrophic-SG rats using a catheter placed into Wharton's duct. IHC and salivary flow rate (SFR) analyses were measured 12 weeks after the transplantation. Following transplantation, donor cells (GFP-SG cells) were primarily located in the ductal region of the SG, and AMY expression in SGs and the SFR were increased in the SG cell transplantation group compared with the control. Those data indicated that cell-based therapy using RI-treated SG cells could restore salivary hypofunction of irradiated SGs by direct integration of the donor cells in the duct of SGs. We propose that these data support future clinical plans in which SG cells would be excised from the labial minor SGs of the patients with head and neck cancers prior to RT, cultured during RT, and auto-transplanted into SGs using a catheter into the Wharton's duct. We believe that our culturing and transplantation methods can be applied to SG cells, constituting a therapeutic approach for the treatment of patients with dry mouth after not only RT but also aging and Sjögren's syndrome.
format Online
Article
Text
id pubmed-9663336
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-96633362022-11-15 A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy Kasamatsu, Atsushi Fukushima, Reo Nakamura, Koki Kawasaki, Kohei Yoshimura, Shusaku Koyama, Tomoyoshi Fukumoto, Chonji Miyamoto, Isao Uzawa, Katsuhiro Biochem Biophys Rep Research Article Radiotherapy (RT) for head and neck cancer results in irreversible damage to salivary glands (SGs) and decreases saliva production, leading to a dry mouth. To date, there are no satisfactory therapies to solve this problem. We recently established a novel culturing method using a Rho kinase inhibitor (RI), Y-27632, that maintained cellular morphology and function for a prolonged period of time. In the present study, we investigated whether cell-based transplantation using our culturing method ameliorated the dysfunction of irradiated SGs. First, rat SG cells were cultured in a medium with RI. Cells were characterized by morphological findings and mRNA expression analysis. We also assessed features of SG cells in three-dimensional (3-D) culture by scanning electron microscopy and immunohistochemistry (IHC). The RI-containing medium led to higher cell proliferation of rat SG cells with preservation of cell morphology and higher alpha-amylase (AMY) expression in both 2-D and 3-D culture systems. To establish the atrophic-SG models, external RT at a dose of 15 Gy was delivered to the head and neck fields of nude rats. The SG cells derived from GFP-rats were cultured in medium with RI, after which they were transplanted into the submandibular glands of atrophic-SG rats using a catheter placed into Wharton's duct. IHC and salivary flow rate (SFR) analyses were measured 12 weeks after the transplantation. Following transplantation, donor cells (GFP-SG cells) were primarily located in the ductal region of the SG, and AMY expression in SGs and the SFR were increased in the SG cell transplantation group compared with the control. Those data indicated that cell-based therapy using RI-treated SG cells could restore salivary hypofunction of irradiated SGs by direct integration of the donor cells in the duct of SGs. We propose that these data support future clinical plans in which SG cells would be excised from the labial minor SGs of the patients with head and neck cancers prior to RT, cultured during RT, and auto-transplanted into SGs using a catheter into the Wharton's duct. We believe that our culturing and transplantation methods can be applied to SG cells, constituting a therapeutic approach for the treatment of patients with dry mouth after not only RT but also aging and Sjögren's syndrome. Elsevier 2022-11-12 /pmc/articles/PMC9663336/ /pubmed/36386443 http://dx.doi.org/10.1016/j.bbrep.2022.101385 Text en © 2022 The Authors https://creativecommons.org/licenses/by/4.0/This is an open access article under the CC BY license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Research Article
Kasamatsu, Atsushi
Fukushima, Reo
Nakamura, Koki
Kawasaki, Kohei
Yoshimura, Shusaku
Koyama, Tomoyoshi
Fukumoto, Chonji
Miyamoto, Isao
Uzawa, Katsuhiro
A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title_full A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title_fullStr A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title_full_unstemmed A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title_short A novel cell-based transplantation method using a Rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
title_sort novel cell-based transplantation method using a rho kinase inhibitor and a specific catheter device for the treatment of salivary gland damage after head and neck radiotherapy
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9663336/
https://www.ncbi.nlm.nih.gov/pubmed/36386443
http://dx.doi.org/10.1016/j.bbrep.2022.101385
work_keys_str_mv AT kasamatsuatsushi anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT fukushimareo anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT nakamurakoki anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT kawasakikohei anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT yoshimurashusaku anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT koyamatomoyoshi anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT fukumotochonji anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT miyamotoisao anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT uzawakatsuhiro anovelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT kasamatsuatsushi novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT fukushimareo novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT nakamurakoki novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT kawasakikohei novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT yoshimurashusaku novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT koyamatomoyoshi novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT fukumotochonji novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT miyamotoisao novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy
AT uzawakatsuhiro novelcellbasedtransplantationmethodusingarhokinaseinhibitorandaspecificcatheterdeviceforthetreatmentofsalivaryglanddamageafterheadandneckradiotherapy