Cargando…
Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study
BACKGROUND: Weight-related stigma has negative physiological and psychological impacts on individuals’ quality of life. Stigmatized individuals may experience higher psychological distress and therefore increase the potential risk to develop obesity and/or food addiction. The present study examined...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9682751/ https://www.ncbi.nlm.nih.gov/pubmed/36414956 http://dx.doi.org/10.1186/s40337-022-00701-y |
_version_ | 1784834922038427648 |
---|---|
author | Huang, Po-Ching Lee, Chiu-Hsiang Griffiths, Mark D. O’Brien, Kerry S. Lin, Yi-Ching Gan, Wan Ying Poon, Wai Chuen Hung, Ching-Hsia Lee, Kuo-Hsin Lin, Chung-Ying |
author_facet | Huang, Po-Ching Lee, Chiu-Hsiang Griffiths, Mark D. O’Brien, Kerry S. Lin, Yi-Ching Gan, Wan Ying Poon, Wai Chuen Hung, Ching-Hsia Lee, Kuo-Hsin Lin, Chung-Ying |
author_sort | Huang, Po-Ching |
collection | PubMed |
description | BACKGROUND: Weight-related stigma has negative physiological and psychological impacts on individuals’ quality of life. Stigmatized individuals may experience higher psychological distress and therefore increase the potential risk to develop obesity and/or food addiction. The present study examined the associations and mediated effect between perceived weight stigma, weight-related self-stigma, and psychological distress in explaining food addiction among Taiwanese university students. METHODS: All participants (n = 968) completed an online survey which included the Perceived Weight Stigma Questionnaire, Weight Self-Stigma Questionnaire, Depression, Anxiety, Stress Scale-21, and Yale Food Addiction Scale Version 2. RESULTS: After controlling for demographic variables, significant associations were found in the paths from (1) perceived weight stigma to weight-related self-stigma ([Formula: see text] = 0.23), psychological distress ([Formula: see text] = 0.35), and food addiction ([Formula: see text] = 0.23); (2) weight-related self-stigma to psychological distress ([Formula: see text] = 0.52) and food addiction ([Formula: see text] = 0.59); and (3) psychological distress to food addiction ([Formula: see text] = 0.59) (all p-values < 0.001). The mediation model showed the sequential mediated effect of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction. CONCLUSIONS: The results provide novel insights that weight-related self-stigma and psychological distress sequentially mediated the relationship between perceived weight stigma and food addiction among Taiwanese university students. The findings of the present study could be implemented into interventions that aim to reduce food addiction derived from weight-related stigma. Future studies should consider group analysis to consider confounding factors or other populations to provide more evidence regarding the mechanism of weight-related stigma. |
format | Online Article Text |
id | pubmed-9682751 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-96827512022-11-24 Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study Huang, Po-Ching Lee, Chiu-Hsiang Griffiths, Mark D. O’Brien, Kerry S. Lin, Yi-Ching Gan, Wan Ying Poon, Wai Chuen Hung, Ching-Hsia Lee, Kuo-Hsin Lin, Chung-Ying J Eat Disord Research BACKGROUND: Weight-related stigma has negative physiological and psychological impacts on individuals’ quality of life. Stigmatized individuals may experience higher psychological distress and therefore increase the potential risk to develop obesity and/or food addiction. The present study examined the associations and mediated effect between perceived weight stigma, weight-related self-stigma, and psychological distress in explaining food addiction among Taiwanese university students. METHODS: All participants (n = 968) completed an online survey which included the Perceived Weight Stigma Questionnaire, Weight Self-Stigma Questionnaire, Depression, Anxiety, Stress Scale-21, and Yale Food Addiction Scale Version 2. RESULTS: After controlling for demographic variables, significant associations were found in the paths from (1) perceived weight stigma to weight-related self-stigma ([Formula: see text] = 0.23), psychological distress ([Formula: see text] = 0.35), and food addiction ([Formula: see text] = 0.23); (2) weight-related self-stigma to psychological distress ([Formula: see text] = 0.52) and food addiction ([Formula: see text] = 0.59); and (3) psychological distress to food addiction ([Formula: see text] = 0.59) (all p-values < 0.001). The mediation model showed the sequential mediated effect of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction. CONCLUSIONS: The results provide novel insights that weight-related self-stigma and psychological distress sequentially mediated the relationship between perceived weight stigma and food addiction among Taiwanese university students. The findings of the present study could be implemented into interventions that aim to reduce food addiction derived from weight-related stigma. Future studies should consider group analysis to consider confounding factors or other populations to provide more evidence regarding the mechanism of weight-related stigma. BioMed Central 2022-11-21 /pmc/articles/PMC9682751/ /pubmed/36414956 http://dx.doi.org/10.1186/s40337-022-00701-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Huang, Po-Ching Lee, Chiu-Hsiang Griffiths, Mark D. O’Brien, Kerry S. Lin, Yi-Ching Gan, Wan Ying Poon, Wai Chuen Hung, Ching-Hsia Lee, Kuo-Hsin Lin, Chung-Ying Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title | Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title_full | Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title_fullStr | Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title_full_unstemmed | Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title_short | Sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among Taiwanese university students: A cross-sectional study |
title_sort | sequentially mediated effects of weight-related self-stigma and psychological distress in the association between perceived weight stigma and food addiction among taiwanese university students: a cross-sectional study |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9682751/ https://www.ncbi.nlm.nih.gov/pubmed/36414956 http://dx.doi.org/10.1186/s40337-022-00701-y |
work_keys_str_mv | AT huangpoching sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT leechiuhsiang sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT griffithsmarkd sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT obrienkerrys sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT linyiching sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT ganwanying sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT poonwaichuen sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT hungchinghsia sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT leekuohsin sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy AT linchungying sequentiallymediatedeffectsofweightrelatedselfstigmaandpsychologicaldistressintheassociationbetweenperceivedweightstigmaandfoodaddictionamongtaiwaneseuniversitystudentsacrosssectionalstudy |