Cargando…

A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes

Anthracyclines, widely used to treat breast cancer, have the potential for cardiotoxicity. We have previously identified and validated a germline single nucleotide polymorphism, rs28714259, associated with an increased risk of anthracycline-induced heart failure. We now provide insights into the mec...

Descripción completa

Detalles Bibliográficos
Autores principales: Wu, Xi, Shen, Fei, Jiang, Guanglong, Xue, Gloria, Philips, Santosh, Gardner, Laura, Cunningham, Geneva, Bales, Casey, Cantor, Erica, Schneider, Bryan Paul
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9684507/
https://www.ncbi.nlm.nih.gov/pubmed/36418322
http://dx.doi.org/10.1038/s41467-022-34917-y
_version_ 1784835298672246784
author Wu, Xi
Shen, Fei
Jiang, Guanglong
Xue, Gloria
Philips, Santosh
Gardner, Laura
Cunningham, Geneva
Bales, Casey
Cantor, Erica
Schneider, Bryan Paul
author_facet Wu, Xi
Shen, Fei
Jiang, Guanglong
Xue, Gloria
Philips, Santosh
Gardner, Laura
Cunningham, Geneva
Bales, Casey
Cantor, Erica
Schneider, Bryan Paul
author_sort Wu, Xi
collection PubMed
description Anthracyclines, widely used to treat breast cancer, have the potential for cardiotoxicity. We have previously identified and validated a germline single nucleotide polymorphism, rs28714259, associated with an increased risk of anthracycline-induced heart failure. We now provide insights into the mechanism by which rs28714259 might confer increased risk of cardiac damage. Using hiPSC-derived cardiomyocyte cell lines with either intrinsic polymorphism or CRISPR-Cas9-mediated deletion of rs28714259 locus, we demonstrate that glucocorticoid receptor signaling activated by dexamethasone pretreatment prior to doxorubicin exposure preserves cardiomyocyte viability and contractility in cardiomyocytes containing the major allele. Homozygous loss of the rs28714259 major allele diminishes dexamethasone’s protective effect. We further demonstrate that the risk allele of rs28714259 disrupts glucocorticoid receptor and rs28714259 binding affinity. Finally, we highlight the activation of genes and pathways involved in cardiac hypertrophy signaling that are blocked by the risk allele, suggesting a decreased adaptive survival response to doxorubicin-related stress.
format Online
Article
Text
id pubmed-9684507
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-96845072022-11-25 A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes Wu, Xi Shen, Fei Jiang, Guanglong Xue, Gloria Philips, Santosh Gardner, Laura Cunningham, Geneva Bales, Casey Cantor, Erica Schneider, Bryan Paul Nat Commun Article Anthracyclines, widely used to treat breast cancer, have the potential for cardiotoxicity. We have previously identified and validated a germline single nucleotide polymorphism, rs28714259, associated with an increased risk of anthracycline-induced heart failure. We now provide insights into the mechanism by which rs28714259 might confer increased risk of cardiac damage. Using hiPSC-derived cardiomyocyte cell lines with either intrinsic polymorphism or CRISPR-Cas9-mediated deletion of rs28714259 locus, we demonstrate that glucocorticoid receptor signaling activated by dexamethasone pretreatment prior to doxorubicin exposure preserves cardiomyocyte viability and contractility in cardiomyocytes containing the major allele. Homozygous loss of the rs28714259 major allele diminishes dexamethasone’s protective effect. We further demonstrate that the risk allele of rs28714259 disrupts glucocorticoid receptor and rs28714259 binding affinity. Finally, we highlight the activation of genes and pathways involved in cardiac hypertrophy signaling that are blocked by the risk allele, suggesting a decreased adaptive survival response to doxorubicin-related stress. Nature Publishing Group UK 2022-11-22 /pmc/articles/PMC9684507/ /pubmed/36418322 http://dx.doi.org/10.1038/s41467-022-34917-y Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Wu, Xi
Shen, Fei
Jiang, Guanglong
Xue, Gloria
Philips, Santosh
Gardner, Laura
Cunningham, Geneva
Bales, Casey
Cantor, Erica
Schneider, Bryan Paul
A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title_full A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title_fullStr A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title_full_unstemmed A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title_short A non-coding GWAS variant impacts anthracycline-induced cardiotoxic phenotypes in human iPSC-derived cardiomyocytes
title_sort non-coding gwas variant impacts anthracycline-induced cardiotoxic phenotypes in human ipsc-derived cardiomyocytes
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9684507/
https://www.ncbi.nlm.nih.gov/pubmed/36418322
http://dx.doi.org/10.1038/s41467-022-34917-y
work_keys_str_mv AT wuxi anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT shenfei anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT jiangguanglong anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT xuegloria anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT philipssantosh anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT gardnerlaura anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT cunninghamgeneva anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT balescasey anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT cantorerica anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT schneiderbryanpaul anoncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT wuxi noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT shenfei noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT jiangguanglong noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT xuegloria noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT philipssantosh noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT gardnerlaura noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT cunninghamgeneva noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT balescasey noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT cantorerica noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes
AT schneiderbryanpaul noncodinggwasvariantimpactsanthracyclineinducedcardiotoxicphenotypesinhumanipscderivedcardiomyocytes