Cargando…
Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study
BACKGROUND: Non-alcoholic simple fatty liver disease patients have very low compliance with almost all types of physical activities. A transtheoretical model-oriented lifestyle modification plan awakens the patient’s consciousness in the pre-intention stage. Aim to evaluate whether a management by s...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9685906/ https://www.ncbi.nlm.nih.gov/pubmed/36424552 http://dx.doi.org/10.1186/s12876-022-02506-4 |
_version_ | 1784835623071252480 |
---|---|
author | Li, Lijuan Hou, Kun Yuan, Mengya Zhang, Yan Zhang, Yang |
author_facet | Li, Lijuan Hou, Kun Yuan, Mengya Zhang, Yan Zhang, Yang |
author_sort | Li, Lijuan |
collection | PubMed |
description | BACKGROUND: Non-alcoholic simple fatty liver disease patients have very low compliance with almost all types of physical activities. A transtheoretical model-oriented lifestyle modification plan awakens the patient’s consciousness in the pre-intention stage. Aim to evaluate whether a management by stages of change plan based on the Transtheoretical Model and Stages of Change promoted behavior change for patients with non-alcoholic simple fatty liver disease. METHODS: Patients with simple fatty liver diagnosed from July to December 2019 were randomly divided into the transtheoretical model and non-transtheoretical model groups. Primary outcome was change in health belief and health behavior based on questionnaires. Secondary outcomes included changes in blood lipids, body mass indexes, and waist circumference 12-months after intervention. RESULTS: Of 200 enrolled patients 194 were analyzed (non-transtheoretical model group n = 98, transtheoretical model group n = 96). After intervention, total health belief scores (120.91 ± 4.94 vs. 118.82 ± 5.48) and total health behavior scores (131.71 ± 5.87 vs. 119.96 ± 7.12) were higher in the transtheoretical model group (all P < 0.05). Blood lipids, body mass index, and waist circumference more obviously improved in the transtheoretical model group (all P < 0.05). CONCLUSION: A transtheoretical model-based lifestyle modification intervention can be effectively applied to patients with non-alcoholic simple fatty liver. CLINICAL RESEARCH REGISTRATION NUMBER: ChiCTR2100049354. The registration date is August 1, 2021. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12876-022-02506-4. |
format | Online Article Text |
id | pubmed-9685906 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-96859062022-11-25 Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study Li, Lijuan Hou, Kun Yuan, Mengya Zhang, Yan Zhang, Yang BMC Gastroenterol Research BACKGROUND: Non-alcoholic simple fatty liver disease patients have very low compliance with almost all types of physical activities. A transtheoretical model-oriented lifestyle modification plan awakens the patient’s consciousness in the pre-intention stage. Aim to evaluate whether a management by stages of change plan based on the Transtheoretical Model and Stages of Change promoted behavior change for patients with non-alcoholic simple fatty liver disease. METHODS: Patients with simple fatty liver diagnosed from July to December 2019 were randomly divided into the transtheoretical model and non-transtheoretical model groups. Primary outcome was change in health belief and health behavior based on questionnaires. Secondary outcomes included changes in blood lipids, body mass indexes, and waist circumference 12-months after intervention. RESULTS: Of 200 enrolled patients 194 were analyzed (non-transtheoretical model group n = 98, transtheoretical model group n = 96). After intervention, total health belief scores (120.91 ± 4.94 vs. 118.82 ± 5.48) and total health behavior scores (131.71 ± 5.87 vs. 119.96 ± 7.12) were higher in the transtheoretical model group (all P < 0.05). Blood lipids, body mass index, and waist circumference more obviously improved in the transtheoretical model group (all P < 0.05). CONCLUSION: A transtheoretical model-based lifestyle modification intervention can be effectively applied to patients with non-alcoholic simple fatty liver. CLINICAL RESEARCH REGISTRATION NUMBER: ChiCTR2100049354. The registration date is August 1, 2021. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12876-022-02506-4. BioMed Central 2022-11-23 /pmc/articles/PMC9685906/ /pubmed/36424552 http://dx.doi.org/10.1186/s12876-022-02506-4 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Li, Lijuan Hou, Kun Yuan, Mengya Zhang, Yan Zhang, Yang Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title | Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title_full | Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title_fullStr | Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title_full_unstemmed | Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title_short | Change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
title_sort | change lifestyle modification plan/transtheoretical model in non-alcoholic simple fatty liver disease: a pilot randomized study |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9685906/ https://www.ncbi.nlm.nih.gov/pubmed/36424552 http://dx.doi.org/10.1186/s12876-022-02506-4 |
work_keys_str_mv | AT lilijuan changelifestylemodificationplantranstheoreticalmodelinnonalcoholicsimplefattyliverdiseaseapilotrandomizedstudy AT houkun changelifestylemodificationplantranstheoreticalmodelinnonalcoholicsimplefattyliverdiseaseapilotrandomizedstudy AT yuanmengya changelifestylemodificationplantranstheoreticalmodelinnonalcoholicsimplefattyliverdiseaseapilotrandomizedstudy AT zhangyan changelifestylemodificationplantranstheoreticalmodelinnonalcoholicsimplefattyliverdiseaseapilotrandomizedstudy AT zhangyang changelifestylemodificationplantranstheoreticalmodelinnonalcoholicsimplefattyliverdiseaseapilotrandomizedstudy |