Cargando…

The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function

Circulating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhib...

Descripción completa

Detalles Bibliográficos
Autor principal: Gambaryan, Stepan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9688146/
https://www.ncbi.nlm.nih.gov/pubmed/36429131
http://dx.doi.org/10.3390/cells11223704
_version_ 1784836193608794112
author Gambaryan, Stepan
author_facet Gambaryan, Stepan
author_sort Gambaryan, Stepan
collection PubMed
description Circulating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhibition, which is supported by a large body of studies and data. This review focused on inconsistent and controversial data of NO/sGC/cGMP/PKG signaling in platelets including sources of NO that activate sGC in platelets, the role of sGC/PKG in platelet inhibition/activation, and the complexity of the regulation of platelet inhibitory mechanisms by cGMP/PKG pathways. In conclusion, we suggest that the recently developed quantitative phosphoproteomic method will be a powerful tool for the analysis of PKG-mediated effects. Analysis of phosphoproteins in PKG-activated platelets will reveal many new PKG substrates. A future detailed analysis of these substrates and their involvement in different platelet inhibitory pathways could be a basis for the development of new antiplatelet drugs that may target only specific aspects of platelet functions.
format Online
Article
Text
id pubmed-9688146
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-96881462022-11-25 The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function Gambaryan, Stepan Cells Review Circulating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhibition, which is supported by a large body of studies and data. This review focused on inconsistent and controversial data of NO/sGC/cGMP/PKG signaling in platelets including sources of NO that activate sGC in platelets, the role of sGC/PKG in platelet inhibition/activation, and the complexity of the regulation of platelet inhibitory mechanisms by cGMP/PKG pathways. In conclusion, we suggest that the recently developed quantitative phosphoproteomic method will be a powerful tool for the analysis of PKG-mediated effects. Analysis of phosphoproteins in PKG-activated platelets will reveal many new PKG substrates. A future detailed analysis of these substrates and their involvement in different platelet inhibitory pathways could be a basis for the development of new antiplatelet drugs that may target only specific aspects of platelet functions. MDPI 2022-11-21 /pmc/articles/PMC9688146/ /pubmed/36429131 http://dx.doi.org/10.3390/cells11223704 Text en © 2022 by the author. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Gambaryan, Stepan
The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title_full The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title_fullStr The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title_full_unstemmed The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title_short The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
title_sort role of no/sgc/cgmp/pkg signaling pathway in regulation of platelet function
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9688146/
https://www.ncbi.nlm.nih.gov/pubmed/36429131
http://dx.doi.org/10.3390/cells11223704
work_keys_str_mv AT gambaryanstepan theroleofnosgccgmppkgsignalingpathwayinregulationofplateletfunction
AT gambaryanstepan roleofnosgccgmppkgsignalingpathwayinregulationofplateletfunction