Cargando…
Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identifica...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9689908/ https://www.ncbi.nlm.nih.gov/pubmed/36360250 http://dx.doi.org/10.3390/genes13112013 |
_version_ | 1784836653534150656 |
---|---|
author | Murali, Madhavi Saloura, Vassiliki |
author_facet | Murali, Madhavi Saloura, Vassiliki |
author_sort | Murali, Madhavi |
collection | PubMed |
description | Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identification of novel therapeutic targets urgent. Recently, research endeavors have focused on how epigenetic modifications may affect tumor initiation and progression of HNSCC. The nuclear receptor binding SET domain (NSD) family of protein methyltransferases NSD1-NSD3 is of particular interest for HNSCC, with NSD1 and NSD3 being amongst the most commonly mutated or amplified genes respectively in HNSCC. Preclinical studies have identified both oncogenic and tumor-suppressing properties across NSD1, NSD2, and NSD3 within the context of HNSCC. The purpose of this review is to provide a better understanding of the contribution of the NSD family of protein methyltransferases to the pathogenesis of HNSCC, underscoring their promise as novel therapeutic targets in this devastating disease. |
format | Online Article Text |
id | pubmed-9689908 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-96899082022-11-25 Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma Murali, Madhavi Saloura, Vassiliki Genes (Basel) Review Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identification of novel therapeutic targets urgent. Recently, research endeavors have focused on how epigenetic modifications may affect tumor initiation and progression of HNSCC. The nuclear receptor binding SET domain (NSD) family of protein methyltransferases NSD1-NSD3 is of particular interest for HNSCC, with NSD1 and NSD3 being amongst the most commonly mutated or amplified genes respectively in HNSCC. Preclinical studies have identified both oncogenic and tumor-suppressing properties across NSD1, NSD2, and NSD3 within the context of HNSCC. The purpose of this review is to provide a better understanding of the contribution of the NSD family of protein methyltransferases to the pathogenesis of HNSCC, underscoring their promise as novel therapeutic targets in this devastating disease. MDPI 2022-11-02 /pmc/articles/PMC9689908/ /pubmed/36360250 http://dx.doi.org/10.3390/genes13112013 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Murali, Madhavi Saloura, Vassiliki Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title | Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title_full | Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title_fullStr | Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title_full_unstemmed | Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title_short | Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma |
title_sort | understanding the roles of the nsd protein methyltransferases in head and neck squamous cell carcinoma |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9689908/ https://www.ncbi.nlm.nih.gov/pubmed/36360250 http://dx.doi.org/10.3390/genes13112013 |
work_keys_str_mv | AT muralimadhavi understandingtherolesofthensdproteinmethyltransferasesinheadandnecksquamouscellcarcinoma AT salouravassiliki understandingtherolesofthensdproteinmethyltransferasesinheadandnecksquamouscellcarcinoma |