Cargando…

Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma

Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identifica...

Descripción completa

Detalles Bibliográficos
Autores principales: Murali, Madhavi, Saloura, Vassiliki
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9689908/
https://www.ncbi.nlm.nih.gov/pubmed/36360250
http://dx.doi.org/10.3390/genes13112013
_version_ 1784836653534150656
author Murali, Madhavi
Saloura, Vassiliki
author_facet Murali, Madhavi
Saloura, Vassiliki
author_sort Murali, Madhavi
collection PubMed
description Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identification of novel therapeutic targets urgent. Recently, research endeavors have focused on how epigenetic modifications may affect tumor initiation and progression of HNSCC. The nuclear receptor binding SET domain (NSD) family of protein methyltransferases NSD1-NSD3 is of particular interest for HNSCC, with NSD1 and NSD3 being amongst the most commonly mutated or amplified genes respectively in HNSCC. Preclinical studies have identified both oncogenic and tumor-suppressing properties across NSD1, NSD2, and NSD3 within the context of HNSCC. The purpose of this review is to provide a better understanding of the contribution of the NSD family of protein methyltransferases to the pathogenesis of HNSCC, underscoring their promise as novel therapeutic targets in this devastating disease.
format Online
Article
Text
id pubmed-9689908
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-96899082022-11-25 Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma Murali, Madhavi Saloura, Vassiliki Genes (Basel) Review Head and neck squamous cell carcinoma (HNSCC) is the sixth most prevalent non-skin cancer in the world. While immunotherapy has revolutionized the standard of care treatment in patients with recurrent/metastatic HNSCC, more than 70% of patients do not respond to this treatment, making the identification of novel therapeutic targets urgent. Recently, research endeavors have focused on how epigenetic modifications may affect tumor initiation and progression of HNSCC. The nuclear receptor binding SET domain (NSD) family of protein methyltransferases NSD1-NSD3 is of particular interest for HNSCC, with NSD1 and NSD3 being amongst the most commonly mutated or amplified genes respectively in HNSCC. Preclinical studies have identified both oncogenic and tumor-suppressing properties across NSD1, NSD2, and NSD3 within the context of HNSCC. The purpose of this review is to provide a better understanding of the contribution of the NSD family of protein methyltransferases to the pathogenesis of HNSCC, underscoring their promise as novel therapeutic targets in this devastating disease. MDPI 2022-11-02 /pmc/articles/PMC9689908/ /pubmed/36360250 http://dx.doi.org/10.3390/genes13112013 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Murali, Madhavi
Saloura, Vassiliki
Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title_full Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title_fullStr Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title_full_unstemmed Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title_short Understanding the Roles of the NSD Protein Methyltransferases in Head and Neck Squamous Cell Carcinoma
title_sort understanding the roles of the nsd protein methyltransferases in head and neck squamous cell carcinoma
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9689908/
https://www.ncbi.nlm.nih.gov/pubmed/36360250
http://dx.doi.org/10.3390/genes13112013
work_keys_str_mv AT muralimadhavi understandingtherolesofthensdproteinmethyltransferasesinheadandnecksquamouscellcarcinoma
AT salouravassiliki understandingtherolesofthensdproteinmethyltransferasesinheadandnecksquamouscellcarcinoma