Cargando…
Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study
CIPKs are a subclass of serine/threonine (Ser/Thr) protein kinases. CBLs are ubiquitous Ca(2+) sensors that interact with CIPK with the aid of secondary Ca(2+) messengers for regulation of growth and development and response to stresses faced by plants. The divergent roles of the CIPK-CBL interactio...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9705351/ https://www.ncbi.nlm.nih.gov/pubmed/36457742 http://dx.doi.org/10.3389/fgene.2022.1041078 |
_version_ | 1784840263915536384 |
---|---|
author | Yang, Chen Yi-feng, Jin Yushu, Wang Yansong, Gao Qi, Wang Xue, You |
author_facet | Yang, Chen Yi-feng, Jin Yushu, Wang Yansong, Gao Qi, Wang Xue, You |
author_sort | Yang, Chen |
collection | PubMed |
description | CIPKs are a subclass of serine/threonine (Ser/Thr) protein kinases. CBLs are ubiquitous Ca(2+) sensors that interact with CIPK with the aid of secondary Ca(2+) messengers for regulation of growth and development and response to stresses faced by plants. The divergent roles of the CIPK-CBL interaction in plants include responding to environmental stresses (salt, cold, drought, pH, ABA signaling, and ion toxicity), ion homeostasis (K(+), NH(4) (+), NO(3) (−), and microelement homeostasis), biotic stress, and plant development. Each member of this gene family produces distinct proteins that help plants adapt to diverse stresses or stimuli by interacting with calcium ion signals. CIPK consists of two structural domains—an N-terminal domain and a C-terminal domain—connected by a junction domain. The N-terminal domain, the site of phosphorylation, is also called the activation domain and kinase domain. The C-terminal, also known as the regulatory domain of CIPK, further comprises NAF/FISL and PPI. CBL comprises four EF domains and conserved PFPF motifs and is the site of binding with the NAF/FISL domain of CIPK to form a CBL-CIPK complex. In addition, we also performed a bibliometric analysis of the CIPK gene family of data extracted from the WoSCC. A total of 95 documents were retrieved, which had been published by 47 sources. The production over time was zigzagged. The top key terms were gene, CIPK, abiotic stress, and gene expression. Beijing Forestry University was the top affiliation, while The Plant Cell was the top source. The genomics and metabolomics of this gene family require more study. |
format | Online Article Text |
id | pubmed-9705351 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-97053512022-11-30 Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study Yang, Chen Yi-feng, Jin Yushu, Wang Yansong, Gao Qi, Wang Xue, You Front Genet Genetics CIPKs are a subclass of serine/threonine (Ser/Thr) protein kinases. CBLs are ubiquitous Ca(2+) sensors that interact with CIPK with the aid of secondary Ca(2+) messengers for regulation of growth and development and response to stresses faced by plants. The divergent roles of the CIPK-CBL interaction in plants include responding to environmental stresses (salt, cold, drought, pH, ABA signaling, and ion toxicity), ion homeostasis (K(+), NH(4) (+), NO(3) (−), and microelement homeostasis), biotic stress, and plant development. Each member of this gene family produces distinct proteins that help plants adapt to diverse stresses or stimuli by interacting with calcium ion signals. CIPK consists of two structural domains—an N-terminal domain and a C-terminal domain—connected by a junction domain. The N-terminal domain, the site of phosphorylation, is also called the activation domain and kinase domain. The C-terminal, also known as the regulatory domain of CIPK, further comprises NAF/FISL and PPI. CBL comprises four EF domains and conserved PFPF motifs and is the site of binding with the NAF/FISL domain of CIPK to form a CBL-CIPK complex. In addition, we also performed a bibliometric analysis of the CIPK gene family of data extracted from the WoSCC. A total of 95 documents were retrieved, which had been published by 47 sources. The production over time was zigzagged. The top key terms were gene, CIPK, abiotic stress, and gene expression. Beijing Forestry University was the top affiliation, while The Plant Cell was the top source. The genomics and metabolomics of this gene family require more study. Frontiers Media S.A. 2022-11-15 /pmc/articles/PMC9705351/ /pubmed/36457742 http://dx.doi.org/10.3389/fgene.2022.1041078 Text en Copyright © 2022 Yang, Yi-feng, Yushu, Yansong, Qi and Xue. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Genetics Yang, Chen Yi-feng, Jin Yushu, Wang Yansong, Gao Qi, Wang Xue, You Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title | Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title_full | Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title_fullStr | Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title_full_unstemmed | Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title_short | Diverse roles of the CIPK gene family in transcription regulation and various biotic and abiotic stresses: A literature review and bibliometric study |
title_sort | diverse roles of the cipk gene family in transcription regulation and various biotic and abiotic stresses: a literature review and bibliometric study |
topic | Genetics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9705351/ https://www.ncbi.nlm.nih.gov/pubmed/36457742 http://dx.doi.org/10.3389/fgene.2022.1041078 |
work_keys_str_mv | AT yangchen diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy AT yifengjin diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy AT yushuwang diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy AT yansonggao diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy AT qiwang diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy AT xueyou diverserolesofthecipkgenefamilyintranscriptionregulationandvariousbioticandabioticstressesaliteraturereviewandbibliometricstudy |