Cargando…
Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms
Bacillus sp. NRC5 is a new strain that grows in Egyptian beaches. This strain produces acidic exo-polysaccharide that have excellent antioxidant, anti-inflammatory and anti-tumor properties. The current study aimed to introduce a new natural product feasible for prostate cancer therapies. The anti-p...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9708816/ https://www.ncbi.nlm.nih.gov/pubmed/36445555 http://dx.doi.org/10.1007/s00284-022-03098-8 |
_version_ | 1784841022028644352 |
---|---|
author | Ibrahim, Abeer Y. Mahmoud, Manal G. Asker, Mohsen S. Youness, Eman R. El-Newary, Samah A. |
author_facet | Ibrahim, Abeer Y. Mahmoud, Manal G. Asker, Mohsen S. Youness, Eman R. El-Newary, Samah A. |
author_sort | Ibrahim, Abeer Y. |
collection | PubMed |
description | Bacillus sp. NRC5 is a new strain that grows in Egyptian beaches. This strain produces acidic exo-polysaccharide that have excellent antioxidant, anti-inflammatory and anti-tumor properties. The current study aimed to introduce a new natural product feasible for prostate cancer therapies. The anti-prostate cancer of acidic exo-polysaccharide produced from marine Bacillus sp. NRC5 (EBPS) was determined using 7,12-dimethylbenz-(a)-anthracene; DMBA-induced prostate cancer in male Sprague Dawley rats. Rats were subcutaneously injected with testosterone (3 mg/kg/day for 3 months) and a single dose of DMBA (65 mg/kg) for induction of prostate cancer. EBPS was administrated orally at dose 200 mg/kg/day for 3 months. To study protective effect of EBPS, animals received EBPS before cancer induction, meanwhile in therapeutic effect animals received EBPS after cancer induction. EBPS debug oxidative stress and inflammatory conditions associated with prostate cancer. EBPS either protective or therapeutic material considerably reduced cancer growth rate-limiting enzyme—i.e., 5-α-reductase (46.89 ± 1.72 and 44.86 ± 2.56 µg Eq/mL) and Na(+)/K(+) ATPase (0.44 ± 0.03 and 0.42 ± 0.02 µg Eq/mL), compared to cancer control (69.68 ± 3.46 µg Eq/mL). In addition, both cancer biomarkers—i.e., prostate-specific antigen and carcinoembryonic antigen were significantly lowered as evidence of the ability of EBPS to protect and treat prostate cancer in chemically induced rats. EBPS showed protective and therapeutic efficacy on testosterone–DMBA-induced prostate cancer rats with a good safety margin. This study may go to clinical trials after a repeated study on another type of small experimental animal, their offspring, and one big experimental animal. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00284-022-03098-8. |
format | Online Article Text |
id | pubmed-9708816 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-97088162022-12-01 Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms Ibrahim, Abeer Y. Mahmoud, Manal G. Asker, Mohsen S. Youness, Eman R. El-Newary, Samah A. Curr Microbiol Article Bacillus sp. NRC5 is a new strain that grows in Egyptian beaches. This strain produces acidic exo-polysaccharide that have excellent antioxidant, anti-inflammatory and anti-tumor properties. The current study aimed to introduce a new natural product feasible for prostate cancer therapies. The anti-prostate cancer of acidic exo-polysaccharide produced from marine Bacillus sp. NRC5 (EBPS) was determined using 7,12-dimethylbenz-(a)-anthracene; DMBA-induced prostate cancer in male Sprague Dawley rats. Rats were subcutaneously injected with testosterone (3 mg/kg/day for 3 months) and a single dose of DMBA (65 mg/kg) for induction of prostate cancer. EBPS was administrated orally at dose 200 mg/kg/day for 3 months. To study protective effect of EBPS, animals received EBPS before cancer induction, meanwhile in therapeutic effect animals received EBPS after cancer induction. EBPS debug oxidative stress and inflammatory conditions associated with prostate cancer. EBPS either protective or therapeutic material considerably reduced cancer growth rate-limiting enzyme—i.e., 5-α-reductase (46.89 ± 1.72 and 44.86 ± 2.56 µg Eq/mL) and Na(+)/K(+) ATPase (0.44 ± 0.03 and 0.42 ± 0.02 µg Eq/mL), compared to cancer control (69.68 ± 3.46 µg Eq/mL). In addition, both cancer biomarkers—i.e., prostate-specific antigen and carcinoembryonic antigen were significantly lowered as evidence of the ability of EBPS to protect and treat prostate cancer in chemically induced rats. EBPS showed protective and therapeutic efficacy on testosterone–DMBA-induced prostate cancer rats with a good safety margin. This study may go to clinical trials after a repeated study on another type of small experimental animal, their offspring, and one big experimental animal. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00284-022-03098-8. Springer US 2022-11-29 2023 /pmc/articles/PMC9708816/ /pubmed/36445555 http://dx.doi.org/10.1007/s00284-022-03098-8 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Ibrahim, Abeer Y. Mahmoud, Manal G. Asker, Mohsen S. Youness, Eman R. El-Newary, Samah A. Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title | Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title_full | Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title_fullStr | Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title_full_unstemmed | Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title_short | Acidic Exo-Polysaccharide Obtained from Bacillus sp. NRC5 Attenuates Testosterone-DMBA-Induced Prostate Cancer in Rats via Inhibition of 5 α-Reductase and Na(+)/K(+) ATPase Activity Mechanisms |
title_sort | acidic exo-polysaccharide obtained from bacillus sp. nrc5 attenuates testosterone-dmba-induced prostate cancer in rats via inhibition of 5 α-reductase and na(+)/k(+) atpase activity mechanisms |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9708816/ https://www.ncbi.nlm.nih.gov/pubmed/36445555 http://dx.doi.org/10.1007/s00284-022-03098-8 |
work_keys_str_mv | AT ibrahimabeery acidicexopolysaccharideobtainedfrombacillusspnrc5attenuatestestosteronedmbainducedprostatecancerinratsviainhibitionof5areductaseandnakatpaseactivitymechanisms AT mahmoudmanalg acidicexopolysaccharideobtainedfrombacillusspnrc5attenuatestestosteronedmbainducedprostatecancerinratsviainhibitionof5areductaseandnakatpaseactivitymechanisms AT askermohsens acidicexopolysaccharideobtainedfrombacillusspnrc5attenuatestestosteronedmbainducedprostatecancerinratsviainhibitionof5areductaseandnakatpaseactivitymechanisms AT younessemanr acidicexopolysaccharideobtainedfrombacillusspnrc5attenuatestestosteronedmbainducedprostatecancerinratsviainhibitionof5areductaseandnakatpaseactivitymechanisms AT elnewarysamaha acidicexopolysaccharideobtainedfrombacillusspnrc5attenuatestestosteronedmbainducedprostatecancerinratsviainhibitionof5areductaseandnakatpaseactivitymechanisms |