Cargando…

Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer

Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Spe...

Descripción completa

Detalles Bibliográficos
Autores principales: Verna, Giulio, Liso, Marina, Cavalcanti, Elisabetta, Armentano, Raffaele, Miraglia, Alessandro, Monsurrò, Vladia, Chieppa, Marcello, De Santis, Stefania
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9737576/
https://www.ncbi.nlm.nih.gov/pubmed/36499472
http://dx.doi.org/10.3390/ijms232315145
_version_ 1784847324747399168
author Verna, Giulio
Liso, Marina
Cavalcanti, Elisabetta
Armentano, Raffaele
Miraglia, Alessandro
Monsurrò, Vladia
Chieppa, Marcello
De Santis, Stefania
author_facet Verna, Giulio
Liso, Marina
Cavalcanti, Elisabetta
Armentano, Raffaele
Miraglia, Alessandro
Monsurrò, Vladia
Chieppa, Marcello
De Santis, Stefania
author_sort Verna, Giulio
collection PubMed
description Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Specifically, a monoclonal antibody that blocks tumor necrosis factor (TNF), infliximab, increases CRC risk in inflammatory bowel disease patients. To address the axis between TNF and CRC development and progression, we depleted the Tnf from our previously established murine model of colitis-associated cancer (CAC), the Winnie-Apc(Min/+) line. We characterized the new Winnie-APC(Min/+-)TNF-KO line through macroscopical and microscopical analyses. Surprisingly, the latter demonstrated that the deletion of Tnf in Winnie-Apc(Min/+) mice resulted in an initial reduction in dysplastic lesion incidence in 5-week-old mice followed by a faster disease progression at 8 weeks. Histological data were confirmed by the molecular profiling obtained from both the real-time PCR analysis of the whole tissue and the RNA sequencing of the macrodissected tumoral lesions from Winnie-APC(Min/+-)TNF-KO distal colon at 8 weeks. Our results highlight that TNF could exert a dual role in CAC, supporting the promotion of neoplastic lesions onset in the early stage of the disease while inducing their reduction during disease progression.
format Online
Article
Text
id pubmed-9737576
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-97375762022-12-11 Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer Verna, Giulio Liso, Marina Cavalcanti, Elisabetta Armentano, Raffaele Miraglia, Alessandro Monsurrò, Vladia Chieppa, Marcello De Santis, Stefania Int J Mol Sci Article Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Specifically, a monoclonal antibody that blocks tumor necrosis factor (TNF), infliximab, increases CRC risk in inflammatory bowel disease patients. To address the axis between TNF and CRC development and progression, we depleted the Tnf from our previously established murine model of colitis-associated cancer (CAC), the Winnie-Apc(Min/+) line. We characterized the new Winnie-APC(Min/+-)TNF-KO line through macroscopical and microscopical analyses. Surprisingly, the latter demonstrated that the deletion of Tnf in Winnie-Apc(Min/+) mice resulted in an initial reduction in dysplastic lesion incidence in 5-week-old mice followed by a faster disease progression at 8 weeks. Histological data were confirmed by the molecular profiling obtained from both the real-time PCR analysis of the whole tissue and the RNA sequencing of the macrodissected tumoral lesions from Winnie-APC(Min/+-)TNF-KO distal colon at 8 weeks. Our results highlight that TNF could exert a dual role in CAC, supporting the promotion of neoplastic lesions onset in the early stage of the disease while inducing their reduction during disease progression. MDPI 2022-12-02 /pmc/articles/PMC9737576/ /pubmed/36499472 http://dx.doi.org/10.3390/ijms232315145 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Verna, Giulio
Liso, Marina
Cavalcanti, Elisabetta
Armentano, Raffaele
Miraglia, Alessandro
Monsurrò, Vladia
Chieppa, Marcello
De Santis, Stefania
Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title_full Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title_fullStr Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title_full_unstemmed Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title_short Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
title_sort deletion of tnf in winnie-apc(min/+) mice reveals its dual role in the onset and progression of colitis-associated colorectal cancer
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9737576/
https://www.ncbi.nlm.nih.gov/pubmed/36499472
http://dx.doi.org/10.3390/ijms232315145
work_keys_str_mv AT vernagiulio deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT lisomarina deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT cavalcantielisabetta deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT armentanoraffaele deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT miragliaalessandro deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT monsurrovladia deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT chieppamarcello deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer
AT desantisstefania deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer