Cargando…
Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer
Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Spe...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9737576/ https://www.ncbi.nlm.nih.gov/pubmed/36499472 http://dx.doi.org/10.3390/ijms232315145 |
_version_ | 1784847324747399168 |
---|---|
author | Verna, Giulio Liso, Marina Cavalcanti, Elisabetta Armentano, Raffaele Miraglia, Alessandro Monsurrò, Vladia Chieppa, Marcello De Santis, Stefania |
author_facet | Verna, Giulio Liso, Marina Cavalcanti, Elisabetta Armentano, Raffaele Miraglia, Alessandro Monsurrò, Vladia Chieppa, Marcello De Santis, Stefania |
author_sort | Verna, Giulio |
collection | PubMed |
description | Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Specifically, a monoclonal antibody that blocks tumor necrosis factor (TNF), infliximab, increases CRC risk in inflammatory bowel disease patients. To address the axis between TNF and CRC development and progression, we depleted the Tnf from our previously established murine model of colitis-associated cancer (CAC), the Winnie-Apc(Min/+) line. We characterized the new Winnie-APC(Min/+-)TNF-KO line through macroscopical and microscopical analyses. Surprisingly, the latter demonstrated that the deletion of Tnf in Winnie-Apc(Min/+) mice resulted in an initial reduction in dysplastic lesion incidence in 5-week-old mice followed by a faster disease progression at 8 weeks. Histological data were confirmed by the molecular profiling obtained from both the real-time PCR analysis of the whole tissue and the RNA sequencing of the macrodissected tumoral lesions from Winnie-APC(Min/+-)TNF-KO distal colon at 8 weeks. Our results highlight that TNF could exert a dual role in CAC, supporting the promotion of neoplastic lesions onset in the early stage of the disease while inducing their reduction during disease progression. |
format | Online Article Text |
id | pubmed-9737576 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-97375762022-12-11 Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer Verna, Giulio Liso, Marina Cavalcanti, Elisabetta Armentano, Raffaele Miraglia, Alessandro Monsurrò, Vladia Chieppa, Marcello De Santis, Stefania Int J Mol Sci Article Colorectal cancer (CRC) is among the best examples for depicting the relationship between inflammation and cancer. The introduction of new therapeutics targeting inflammatory mediators showed a marked decrease in the overall risk of CRC, although their chemopreventive potential is still debated. Specifically, a monoclonal antibody that blocks tumor necrosis factor (TNF), infliximab, increases CRC risk in inflammatory bowel disease patients. To address the axis between TNF and CRC development and progression, we depleted the Tnf from our previously established murine model of colitis-associated cancer (CAC), the Winnie-Apc(Min/+) line. We characterized the new Winnie-APC(Min/+-)TNF-KO line through macroscopical and microscopical analyses. Surprisingly, the latter demonstrated that the deletion of Tnf in Winnie-Apc(Min/+) mice resulted in an initial reduction in dysplastic lesion incidence in 5-week-old mice followed by a faster disease progression at 8 weeks. Histological data were confirmed by the molecular profiling obtained from both the real-time PCR analysis of the whole tissue and the RNA sequencing of the macrodissected tumoral lesions from Winnie-APC(Min/+-)TNF-KO distal colon at 8 weeks. Our results highlight that TNF could exert a dual role in CAC, supporting the promotion of neoplastic lesions onset in the early stage of the disease while inducing their reduction during disease progression. MDPI 2022-12-02 /pmc/articles/PMC9737576/ /pubmed/36499472 http://dx.doi.org/10.3390/ijms232315145 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Verna, Giulio Liso, Marina Cavalcanti, Elisabetta Armentano, Raffaele Miraglia, Alessandro Monsurrò, Vladia Chieppa, Marcello De Santis, Stefania Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title | Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title_full | Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title_fullStr | Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title_full_unstemmed | Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title_short | Deletion of TNF in Winnie-APC(Min/+) Mice Reveals Its Dual Role in the Onset and Progression of Colitis-Associated Colorectal Cancer |
title_sort | deletion of tnf in winnie-apc(min/+) mice reveals its dual role in the onset and progression of colitis-associated colorectal cancer |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9737576/ https://www.ncbi.nlm.nih.gov/pubmed/36499472 http://dx.doi.org/10.3390/ijms232315145 |
work_keys_str_mv | AT vernagiulio deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT lisomarina deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT cavalcantielisabetta deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT armentanoraffaele deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT miragliaalessandro deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT monsurrovladia deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT chieppamarcello deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer AT desantisstefania deletionoftnfinwinnieapcminmicerevealsitsdualroleintheonsetandprogressionofcolitisassociatedcolorectalcancer |