Cargando…
Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022
BACKGROUND: It has been descriptively argued that the case fatality risk (CFR) of coronavirus disease (COVID-19) is elevated when medical services are overwhelmed. The relationship between CFR and pressure on health-care services should thus be epidemiologically explored to account for potential epi...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9744068/ https://www.ncbi.nlm.nih.gov/pubmed/36510193 http://dx.doi.org/10.1186/s12879-022-07929-8 |
_version_ | 1784848841450717184 |
---|---|
author | Hayashi, Katsuma Nishiura, Hiroshi |
author_facet | Hayashi, Katsuma Nishiura, Hiroshi |
author_sort | Hayashi, Katsuma |
collection | PubMed |
description | BACKGROUND: It has been descriptively argued that the case fatality risk (CFR) of coronavirus disease (COVID-19) is elevated when medical services are overwhelmed. The relationship between CFR and pressure on health-care services should thus be epidemiologically explored to account for potential epidemiological biases. The purpose of the present study was to estimate the age-dependent CFR in Tokyo and Osaka over time, investigating the impact of caseload demand on the risk of death. METHODS: We estimated the time-dependent CFR, accounting for time delay from diagnosis to death. To this end, we first determined the time distribution from diagnosis to death, allowing variations in the delay over time. We then assessed the age-dependent CFR in Tokyo and Osaka. In Osaka, the risk of intensive care unit (ICU) admission was also estimated. RESULTS: The CFR was highest among individuals aged 80 years and older and during the first epidemic wave from February to June 2020, estimated as 25.4% (95% confidence interval [CI] 21.1 to 29.6) and 27.9% (95% CI 20.6 to 36.1) in Tokyo and Osaka, respectively. During the fourth wave of infection (caused by the Alpha variant) in Osaka the CFR among the 70s and ≥ 80s age groups was, respectively, 2.3 and 1.5 times greater than in Tokyo. Conversely, despite the surge in hospitalizations, the risk of ICU admission among those aged 80 and older in Osaka decreased. Such time-dependent variation in the CFR was not seen among younger patients < 70 years old. With the Omicron variant, the CFR among the 80s and older in Tokyo and Osaka was 3.2% (95% CI 3.0 to 3.5) and 2.9% (95% CI 2.7 to 3.1), respectively. CONCLUSION: We found that without substantial control, the CFR can increase when a surge in cases occurs with an identifiable elevation in risk—especially among older people. Because active treatment options including admission to ICU cannot be offered to the elderly with an overwhelmed medical service, the CFR value can potentially double compared with that in other areas of health care under less pressure. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12879-022-07929-8. |
format | Online Article Text |
id | pubmed-9744068 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-97440682022-12-13 Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 Hayashi, Katsuma Nishiura, Hiroshi BMC Infect Dis Research BACKGROUND: It has been descriptively argued that the case fatality risk (CFR) of coronavirus disease (COVID-19) is elevated when medical services are overwhelmed. The relationship between CFR and pressure on health-care services should thus be epidemiologically explored to account for potential epidemiological biases. The purpose of the present study was to estimate the age-dependent CFR in Tokyo and Osaka over time, investigating the impact of caseload demand on the risk of death. METHODS: We estimated the time-dependent CFR, accounting for time delay from diagnosis to death. To this end, we first determined the time distribution from diagnosis to death, allowing variations in the delay over time. We then assessed the age-dependent CFR in Tokyo and Osaka. In Osaka, the risk of intensive care unit (ICU) admission was also estimated. RESULTS: The CFR was highest among individuals aged 80 years and older and during the first epidemic wave from February to June 2020, estimated as 25.4% (95% confidence interval [CI] 21.1 to 29.6) and 27.9% (95% CI 20.6 to 36.1) in Tokyo and Osaka, respectively. During the fourth wave of infection (caused by the Alpha variant) in Osaka the CFR among the 70s and ≥ 80s age groups was, respectively, 2.3 and 1.5 times greater than in Tokyo. Conversely, despite the surge in hospitalizations, the risk of ICU admission among those aged 80 and older in Osaka decreased. Such time-dependent variation in the CFR was not seen among younger patients < 70 years old. With the Omicron variant, the CFR among the 80s and older in Tokyo and Osaka was 3.2% (95% CI 3.0 to 3.5) and 2.9% (95% CI 2.7 to 3.1), respectively. CONCLUSION: We found that without substantial control, the CFR can increase when a surge in cases occurs with an identifiable elevation in risk—especially among older people. Because active treatment options including admission to ICU cannot be offered to the elderly with an overwhelmed medical service, the CFR value can potentially double compared with that in other areas of health care under less pressure. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12879-022-07929-8. BioMed Central 2022-12-12 /pmc/articles/PMC9744068/ /pubmed/36510193 http://dx.doi.org/10.1186/s12879-022-07929-8 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Hayashi, Katsuma Nishiura, Hiroshi Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title | Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title_full | Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title_fullStr | Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title_full_unstemmed | Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title_short | Time-dependent risk of COVID-19 death with overwhelmed health-care capacity in Japan, 2020–2022 |
title_sort | time-dependent risk of covid-19 death with overwhelmed health-care capacity in japan, 2020–2022 |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9744068/ https://www.ncbi.nlm.nih.gov/pubmed/36510193 http://dx.doi.org/10.1186/s12879-022-07929-8 |
work_keys_str_mv | AT hayashikatsuma timedependentriskofcovid19deathwithoverwhelmedhealthcarecapacityinjapan20202022 AT nishiurahiroshi timedependentriskofcovid19deathwithoverwhelmedhealthcarecapacityinjapan20202022 |