Cargando…
Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers
INTRODUCTION: In United States, health care workers have been immersed in the COVID-19 pandemic since February 2020. Since availability of COVID-19 vaccines, there is limited literature investigating the incidence of unknown COVID-19 infections in physicians and Advanced Practitioner Providers (APPs...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier Inc.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9749378/ https://www.ncbi.nlm.nih.gov/pubmed/36563499 http://dx.doi.org/10.1016/j.ajem.2022.12.012 |
_version_ | 1784850028701941760 |
---|---|
author | Aaron Nathan Barksdale Wood, Macy G. Branecki, Chad E. Zimmerman, Brooklin Lyden, Elizabeth Nguyen, Thang T. Hatfield, Andrew Koepsell, Scott Langenfeld, Jason Zeger, Wesley G. Wadman, Michael C. |
author_facet | Aaron Nathan Barksdale Wood, Macy G. Branecki, Chad E. Zimmerman, Brooklin Lyden, Elizabeth Nguyen, Thang T. Hatfield, Andrew Koepsell, Scott Langenfeld, Jason Zeger, Wesley G. Wadman, Michael C. |
author_sort | Aaron Nathan Barksdale |
collection | PubMed |
description | INTRODUCTION: In United States, health care workers have been immersed in the COVID-19 pandemic since February 2020. Since availability of COVID-19 vaccines, there is limited literature investigating the incidence of unknown COVID-19 infections in physicians and Advanced Practitioner Providers (APPs) working in emergency departments (EDs). The primary objective is to determine the incidence unknown COVID-19 infection within a cohort of emergency physicians (EPs) and APPs. METHODS: Prospective observational study at a tertiary academic center with emergency medicine residency and 64,000 annual ED visits. EPs/APPs providing care to ED patients over the prior 12 months were eligible. Serum samples were collected between May 1 and June 30, 2022. Analysis utilized Luminex xMAP® SARS-CoV-2 Multi-Antigen IgG Assay for antibodies to Nucleocapsid, Receptor-binding domain, and Spike subunit 1. Mean Fluorescent Intensity (MFI) ≥ 700 was considered positive. Subjects completed 12 question survey assessing demographics and previously confirmed COVID-19 infection. Fisher's exact test evaluated associations of demographics and clinical characteristics with confirmed COVID-19 status. Analyses performed using SAS, Version 9.4. P < 0.05 considered statistically significant. RESULTS: Sixty-nine of 81 eligible subjects (85.2%) participated, 58.0% were male, 97.1% white, with mean age of 37. Eighteen subjects had MFI ≥ 700 strongly suggestive of prior infection, with 17.7% unknown. No statistically significant difference between age, gender, race, children in home, or household member with previously COVID-19 infection. CONCLUSION: Unknown previous COVID-19 infection was less then expected in this cohort of EPs/APPs, and no association with individual characteristics, previously infected household member, or children in the home. |
format | Online Article Text |
id | pubmed-9749378 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Elsevier Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-97493782022-12-14 Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers Aaron Nathan Barksdale Wood, Macy G. Branecki, Chad E. Zimmerman, Brooklin Lyden, Elizabeth Nguyen, Thang T. Hatfield, Andrew Koepsell, Scott Langenfeld, Jason Zeger, Wesley G. Wadman, Michael C. Am J Emerg Med Article INTRODUCTION: In United States, health care workers have been immersed in the COVID-19 pandemic since February 2020. Since availability of COVID-19 vaccines, there is limited literature investigating the incidence of unknown COVID-19 infections in physicians and Advanced Practitioner Providers (APPs) working in emergency departments (EDs). The primary objective is to determine the incidence unknown COVID-19 infection within a cohort of emergency physicians (EPs) and APPs. METHODS: Prospective observational study at a tertiary academic center with emergency medicine residency and 64,000 annual ED visits. EPs/APPs providing care to ED patients over the prior 12 months were eligible. Serum samples were collected between May 1 and June 30, 2022. Analysis utilized Luminex xMAP® SARS-CoV-2 Multi-Antigen IgG Assay for antibodies to Nucleocapsid, Receptor-binding domain, and Spike subunit 1. Mean Fluorescent Intensity (MFI) ≥ 700 was considered positive. Subjects completed 12 question survey assessing demographics and previously confirmed COVID-19 infection. Fisher's exact test evaluated associations of demographics and clinical characteristics with confirmed COVID-19 status. Analyses performed using SAS, Version 9.4. P < 0.05 considered statistically significant. RESULTS: Sixty-nine of 81 eligible subjects (85.2%) participated, 58.0% were male, 97.1% white, with mean age of 37. Eighteen subjects had MFI ≥ 700 strongly suggestive of prior infection, with 17.7% unknown. No statistically significant difference between age, gender, race, children in home, or household member with previously COVID-19 infection. CONCLUSION: Unknown previous COVID-19 infection was less then expected in this cohort of EPs/APPs, and no association with individual characteristics, previously infected household member, or children in the home. Elsevier Inc. 2023-02 2022-12-14 /pmc/articles/PMC9749378/ /pubmed/36563499 http://dx.doi.org/10.1016/j.ajem.2022.12.012 Text en © 2022 Elsevier Inc. All rights reserved. Since January 2020 Elsevier has created a COVID-19 resource centre with free information in English and Mandarin on the novel coronavirus COVID-19. The COVID-19 resource centre is hosted on Elsevier Connect, the company's public news and information website. Elsevier hereby grants permission to make all its COVID-19-related research that is available on the COVID-19 resource centre - including this research content - immediately available in PubMed Central and other publicly funded repositories, such as the WHO COVID database with rights for unrestricted research re-use and analyses in any form or by any means with acknowledgement of the original source. These permissions are granted for free by Elsevier for as long as the COVID-19 resource centre remains active. |
spellingShingle | Article Aaron Nathan Barksdale Wood, Macy G. Branecki, Chad E. Zimmerman, Brooklin Lyden, Elizabeth Nguyen, Thang T. Hatfield, Andrew Koepsell, Scott Langenfeld, Jason Zeger, Wesley G. Wadman, Michael C. Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title | Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title_full | Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title_fullStr | Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title_full_unstemmed | Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title_short | Incidence of unknown COVID-19 infection in a cohort of emergency physicians and advance practice providers |
title_sort | incidence of unknown covid-19 infection in a cohort of emergency physicians and advance practice providers |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9749378/ https://www.ncbi.nlm.nih.gov/pubmed/36563499 http://dx.doi.org/10.1016/j.ajem.2022.12.012 |
work_keys_str_mv | AT aaronnathanbarksdale incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT woodmacyg incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT braneckichade incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT zimmermanbrooklin incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT lydenelizabeth incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT nguyenthangt incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT hatfieldandrew incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT koepsellscott incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT langenfeldjason incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT zegerwesleyg incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders AT wadmanmichaelc incidenceofunknowncovid19infectioninacohortofemergencyphysiciansandadvancepracticeproviders |