Cargando…

Machine learning computational tools to assist the performance of systematic reviews: A mapping review

BACKGROUND: Within evidence-based practice (EBP), systematic reviews (SR) are considered the highest level of evidence in that they summarize the best available research and describe the progress in a determined field. Due its methodology, SR require significant time and resources to be performed; t...

Descripción completa

Detalles Bibliográficos
Autores principales: Cierco Jimenez, Ramon, Lee, Teresa, Rosillo, Nicolás, Cordova, Reynalda, Cree, Ian A, Gonzalez, Angel, Indave Ruiz, Blanca Iciar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9756658/
https://www.ncbi.nlm.nih.gov/pubmed/36522637
http://dx.doi.org/10.1186/s12874-022-01805-4
_version_ 1784851667301171200
author Cierco Jimenez, Ramon
Lee, Teresa
Rosillo, Nicolás
Cordova, Reynalda
Cree, Ian A
Gonzalez, Angel
Indave Ruiz, Blanca Iciar
author_facet Cierco Jimenez, Ramon
Lee, Teresa
Rosillo, Nicolás
Cordova, Reynalda
Cree, Ian A
Gonzalez, Angel
Indave Ruiz, Blanca Iciar
author_sort Cierco Jimenez, Ramon
collection PubMed
description BACKGROUND: Within evidence-based practice (EBP), systematic reviews (SR) are considered the highest level of evidence in that they summarize the best available research and describe the progress in a determined field. Due its methodology, SR require significant time and resources to be performed; they also require repetitive steps that may introduce biases and human errors. Machine learning (ML) algorithms therefore present a promising alternative and a potential game changer to speed up and automate the SR process. This review aims to map the current availability of computational tools that use ML techniques to assist in the performance of SR, and to support authors in the selection of the right software for the performance of evidence synthesis. METHODS: The mapping review was based on comprehensive searches in electronic databases and software repositories to obtain relevant literature and records, followed by screening for eligibility based on titles, abstracts, and full text by two reviewers. The data extraction consisted of listing and extracting the name and basic characteristics of the included tools, for example a tool’s applicability to the various SR stages, pricing options, open-source availability, and type of software. These tools were classified and graphically represented to facilitate the description of our findings. RESULTS: A total of 9653 studies and 585 records were obtained from the structured searches performed on selected bibliometric databases and software repositories respectively. After screening, a total of 119 descriptions from publications and records allowed us to identify 63 tools that assist the SR process using ML techniques. CONCLUSIONS: This review provides a high-quality map of currently available ML software to assist the performance of SR. ML algorithms are arguably one of the best techniques at present for the automation of SR. The most promising tools were easily accessible and included a high number of user-friendly features permitting the automation of SR and other kinds of evidence synthesis reviews. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12874-022-01805-4.
format Online
Article
Text
id pubmed-9756658
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-97566582022-12-17 Machine learning computational tools to assist the performance of systematic reviews: A mapping review Cierco Jimenez, Ramon Lee, Teresa Rosillo, Nicolás Cordova, Reynalda Cree, Ian A Gonzalez, Angel Indave Ruiz, Blanca Iciar BMC Med Res Methodol Research BACKGROUND: Within evidence-based practice (EBP), systematic reviews (SR) are considered the highest level of evidence in that they summarize the best available research and describe the progress in a determined field. Due its methodology, SR require significant time and resources to be performed; they also require repetitive steps that may introduce biases and human errors. Machine learning (ML) algorithms therefore present a promising alternative and a potential game changer to speed up and automate the SR process. This review aims to map the current availability of computational tools that use ML techniques to assist in the performance of SR, and to support authors in the selection of the right software for the performance of evidence synthesis. METHODS: The mapping review was based on comprehensive searches in electronic databases and software repositories to obtain relevant literature and records, followed by screening for eligibility based on titles, abstracts, and full text by two reviewers. The data extraction consisted of listing and extracting the name and basic characteristics of the included tools, for example a tool’s applicability to the various SR stages, pricing options, open-source availability, and type of software. These tools were classified and graphically represented to facilitate the description of our findings. RESULTS: A total of 9653 studies and 585 records were obtained from the structured searches performed on selected bibliometric databases and software repositories respectively. After screening, a total of 119 descriptions from publications and records allowed us to identify 63 tools that assist the SR process using ML techniques. CONCLUSIONS: This review provides a high-quality map of currently available ML software to assist the performance of SR. ML algorithms are arguably one of the best techniques at present for the automation of SR. The most promising tools were easily accessible and included a high number of user-friendly features permitting the automation of SR and other kinds of evidence synthesis reviews. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12874-022-01805-4. BioMed Central 2022-12-16 /pmc/articles/PMC9756658/ /pubmed/36522637 http://dx.doi.org/10.1186/s12874-022-01805-4 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Cierco Jimenez, Ramon
Lee, Teresa
Rosillo, Nicolás
Cordova, Reynalda
Cree, Ian A
Gonzalez, Angel
Indave Ruiz, Blanca Iciar
Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title_full Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title_fullStr Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title_full_unstemmed Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title_short Machine learning computational tools to assist the performance of systematic reviews: A mapping review
title_sort machine learning computational tools to assist the performance of systematic reviews: a mapping review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9756658/
https://www.ncbi.nlm.nih.gov/pubmed/36522637
http://dx.doi.org/10.1186/s12874-022-01805-4
work_keys_str_mv AT ciercojimenezramon machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT leeteresa machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT rosillonicolas machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT cordovareynalda machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT creeiana machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT gonzalezangel machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview
AT indaveruizblancaiciar machinelearningcomputationaltoolstoassisttheperformanceofsystematicreviewsamappingreview