Cargando…

Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection

Global high-throughput phosphoproteomic profiling is increasingly being applied to cancer specimens to identify the oncogenic signaling cascades responsible for promoting disease initiation and disease progression; pathways that are often invisible to genomics analysis. Hence, phosphoproteomic profi...

Descripción completa

Detalles Bibliográficos
Autores principales: Staudt, Dilana E., Murray, Heather C., Skerrett-Byrne, David A., Smith, Nathan D., Jamaluddin, M. Fairuz B., Kahl, Richard G. S., Duchatel, Ryan J., Germon, Zacary P., McLachlan, Tabitha, Jackson, Evangeline R., Findlay, Izac J., Kearney, Padraic S., Mannan, Abdul, McEwen, Holly P., Douglas, Alicia M., Nixon, Brett, Verrills, Nicole M., Dun, Matthew D.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9762002/
https://www.ncbi.nlm.nih.gov/pubmed/36536316
http://dx.doi.org/10.1186/s12014-022-09385-7
_version_ 1784852782231060480
author Staudt, Dilana E.
Murray, Heather C.
Skerrett-Byrne, David A.
Smith, Nathan D.
Jamaluddin, M. Fairuz B.
Kahl, Richard G. S.
Duchatel, Ryan J.
Germon, Zacary P.
McLachlan, Tabitha
Jackson, Evangeline R.
Findlay, Izac J.
Kearney, Padraic S.
Mannan, Abdul
McEwen, Holly P.
Douglas, Alicia M.
Nixon, Brett
Verrills, Nicole M.
Dun, Matthew D.
author_facet Staudt, Dilana E.
Murray, Heather C.
Skerrett-Byrne, David A.
Smith, Nathan D.
Jamaluddin, M. Fairuz B.
Kahl, Richard G. S.
Duchatel, Ryan J.
Germon, Zacary P.
McLachlan, Tabitha
Jackson, Evangeline R.
Findlay, Izac J.
Kearney, Padraic S.
Mannan, Abdul
McEwen, Holly P.
Douglas, Alicia M.
Nixon, Brett
Verrills, Nicole M.
Dun, Matthew D.
author_sort Staudt, Dilana E.
collection PubMed
description Global high-throughput phosphoproteomic profiling is increasingly being applied to cancer specimens to identify the oncogenic signaling cascades responsible for promoting disease initiation and disease progression; pathways that are often invisible to genomics analysis. Hence, phosphoproteomic profiling has enormous potential to inform and improve individualized anti-cancer treatment strategies. However, to achieve the adequate phosphoproteomic depth and coverage necessary to identify the activated, and hence, targetable kinases responsible for driving oncogenic signaling pathways, affinity phosphopeptide enrichment techniques are required and often coupled with offline high-pressure liquid chromatographic (HPLC) separation prior to nanoflow liquid chromatography–tandem mass spectrometry (nLC-MS/MS). These complex and time-consuming procedures, limit the utility of phosphoproteomics for the analysis of individual cancer patient specimens in real-time, and restrict phosphoproteomics to specialized laboratories often outside of the clinical setting. To address these limitations, here we have optimized a new protocol, phospho-heavy-labeled-spiketide FAIMS Stepped-CV DDA (pHASED), that employs online phosphoproteome deconvolution using high-field asymmetric waveform ion mobility spectrometry (FAIMS) and internal phosphopeptide standards to provide accurate label-free quantitation (LFQ) data in real-time. Compared with traditional single-shot LFQ phosphoproteomics workflows, pHASED provided increased phosphoproteomic depth and coverage (phosphopeptides = 4617 pHASED, 2789 LFQ), whilst eliminating the variability associated with offline prefractionation. pHASED was optimized using tyrosine kinase inhibitor (sorafenib) resistant isogenic FLT3-mutant acute myeloid leukemia (AML) cell line models. Bioinformatic analysis identified differential activation of the serine/threonine protein kinase ataxia-telangiectasia mutated (ATM) pathway, responsible for sensing and repairing DNA damage in sorafenib-resistant AML cell line models, thereby uncovering a potential therapeutic opportunity. Herein, we have optimized a rapid, reproducible, and flexible protocol for the characterization of complex cancer phosphoproteomes in real-time, a step towards the implementation of phosphoproteomics in the clinic to aid in the selection of anti-cancer therapies for patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12014-022-09385-7.
format Online
Article
Text
id pubmed-9762002
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-97620022022-12-20 Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection Staudt, Dilana E. Murray, Heather C. Skerrett-Byrne, David A. Smith, Nathan D. Jamaluddin, M. Fairuz B. Kahl, Richard G. S. Duchatel, Ryan J. Germon, Zacary P. McLachlan, Tabitha Jackson, Evangeline R. Findlay, Izac J. Kearney, Padraic S. Mannan, Abdul McEwen, Holly P. Douglas, Alicia M. Nixon, Brett Verrills, Nicole M. Dun, Matthew D. Clin Proteomics Research Global high-throughput phosphoproteomic profiling is increasingly being applied to cancer specimens to identify the oncogenic signaling cascades responsible for promoting disease initiation and disease progression; pathways that are often invisible to genomics analysis. Hence, phosphoproteomic profiling has enormous potential to inform and improve individualized anti-cancer treatment strategies. However, to achieve the adequate phosphoproteomic depth and coverage necessary to identify the activated, and hence, targetable kinases responsible for driving oncogenic signaling pathways, affinity phosphopeptide enrichment techniques are required and often coupled with offline high-pressure liquid chromatographic (HPLC) separation prior to nanoflow liquid chromatography–tandem mass spectrometry (nLC-MS/MS). These complex and time-consuming procedures, limit the utility of phosphoproteomics for the analysis of individual cancer patient specimens in real-time, and restrict phosphoproteomics to specialized laboratories often outside of the clinical setting. To address these limitations, here we have optimized a new protocol, phospho-heavy-labeled-spiketide FAIMS Stepped-CV DDA (pHASED), that employs online phosphoproteome deconvolution using high-field asymmetric waveform ion mobility spectrometry (FAIMS) and internal phosphopeptide standards to provide accurate label-free quantitation (LFQ) data in real-time. Compared with traditional single-shot LFQ phosphoproteomics workflows, pHASED provided increased phosphoproteomic depth and coverage (phosphopeptides = 4617 pHASED, 2789 LFQ), whilst eliminating the variability associated with offline prefractionation. pHASED was optimized using tyrosine kinase inhibitor (sorafenib) resistant isogenic FLT3-mutant acute myeloid leukemia (AML) cell line models. Bioinformatic analysis identified differential activation of the serine/threonine protein kinase ataxia-telangiectasia mutated (ATM) pathway, responsible for sensing and repairing DNA damage in sorafenib-resistant AML cell line models, thereby uncovering a potential therapeutic opportunity. Herein, we have optimized a rapid, reproducible, and flexible protocol for the characterization of complex cancer phosphoproteomes in real-time, a step towards the implementation of phosphoproteomics in the clinic to aid in the selection of anti-cancer therapies for patients. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12014-022-09385-7. BioMed Central 2022-12-19 /pmc/articles/PMC9762002/ /pubmed/36536316 http://dx.doi.org/10.1186/s12014-022-09385-7 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Staudt, Dilana E.
Murray, Heather C.
Skerrett-Byrne, David A.
Smith, Nathan D.
Jamaluddin, M. Fairuz B.
Kahl, Richard G. S.
Duchatel, Ryan J.
Germon, Zacary P.
McLachlan, Tabitha
Jackson, Evangeline R.
Findlay, Izac J.
Kearney, Padraic S.
Mannan, Abdul
McEwen, Holly P.
Douglas, Alicia M.
Nixon, Brett
Verrills, Nicole M.
Dun, Matthew D.
Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title_full Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title_fullStr Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title_full_unstemmed Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title_short Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
title_sort phospho-heavy-labeled-spiketide faims stepped-cv dda (phased) provides real-time phosphoproteomics data to aid in cancer drug selection
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9762002/
https://www.ncbi.nlm.nih.gov/pubmed/36536316
http://dx.doi.org/10.1186/s12014-022-09385-7
work_keys_str_mv AT staudtdilanae phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT murrayheatherc phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT skerrettbyrnedavida phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT smithnathand phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT jamaluddinmfairuzb phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT kahlrichardgs phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT duchatelryanj phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT germonzacaryp phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT mclachlantabitha phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT jacksonevangeliner phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT findlayizacj phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT kearneypadraics phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT mannanabdul phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT mcewenhollyp phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT douglasaliciam phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT nixonbrett phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT verrillsnicolem phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection
AT dunmatthewd phosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection