Cargando…
Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies
Antibodies produced in response to adaptive immunity provide a receptor with multiple sites for binding to a distinct epitope of an antigen. Determining antibody levels to specific antigens has important clinical applications in assessing immune status or deficiency, monitoring infectious or autoimm...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9762857/ https://www.ncbi.nlm.nih.gov/pubmed/36540572 http://dx.doi.org/10.3390/chemosensors10020062 |
_version_ | 1784852937583886336 |
---|---|
author | Tran, Natalie Shiveshwarkar, Priyanka Jaworski, Justyn |
author_facet | Tran, Natalie Shiveshwarkar, Priyanka Jaworski, Justyn |
author_sort | Tran, Natalie |
collection | PubMed |
description | Antibodies produced in response to adaptive immunity provide a receptor with multiple sites for binding to a distinct epitope of an antigen. Determining antibody levels to specific antigens has important clinical applications in assessing immune status or deficiency, monitoring infectious or autoimmune diseases, and diagnosing allergies. Leveraging that a specific antibody will bind to a distinct small peptide epitope without requiring the entire antigen to be present, we demonstrate in this work a proof-of-concept assay to detect the presence of an antibody by using peptide epitopes linked to an amphiphile to generate a vesicle-based sensing system. By affording multiple copies of the epitope site on the vesicle, we revealed that the vesicles visibly aggregate in response to an antibody specific for that epitope due to multivalent binding provided by the antibody. We also uncovered the role of peptide surface density in providing accessible epitopes on the vesicles for antibody binding. In summary, using a peptide derived from the coat protein of human influenza virus directly linked to a diacetylene-containing amphiphile afforded peptide-laden vesicles that proved capable of detecting the presence of antibodies specific for human influenza hemagglutinin. |
format | Online Article Text |
id | pubmed-9762857 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
record_format | MEDLINE/PubMed |
spelling | pubmed-97628572022-12-19 Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies Tran, Natalie Shiveshwarkar, Priyanka Jaworski, Justyn Chemosensors (Basel) Article Antibodies produced in response to adaptive immunity provide a receptor with multiple sites for binding to a distinct epitope of an antigen. Determining antibody levels to specific antigens has important clinical applications in assessing immune status or deficiency, monitoring infectious or autoimmune diseases, and diagnosing allergies. Leveraging that a specific antibody will bind to a distinct small peptide epitope without requiring the entire antigen to be present, we demonstrate in this work a proof-of-concept assay to detect the presence of an antibody by using peptide epitopes linked to an amphiphile to generate a vesicle-based sensing system. By affording multiple copies of the epitope site on the vesicle, we revealed that the vesicles visibly aggregate in response to an antibody specific for that epitope due to multivalent binding provided by the antibody. We also uncovered the role of peptide surface density in providing accessible epitopes on the vesicles for antibody binding. In summary, using a peptide derived from the coat protein of human influenza virus directly linked to a diacetylene-containing amphiphile afforded peptide-laden vesicles that proved capable of detecting the presence of antibodies specific for human influenza hemagglutinin. 2022-02 2022-02-03 /pmc/articles/PMC9762857/ /pubmed/36540572 http://dx.doi.org/10.3390/chemosensors10020062 Text en https://creativecommons.org/licenses/by/4.0/This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Tran, Natalie Shiveshwarkar, Priyanka Jaworski, Justyn Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title | Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title_full | Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title_fullStr | Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title_full_unstemmed | Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title_short | Peptide Linked Diacetylene Amphiphiles for Detection of Epitope Specific Antibodies |
title_sort | peptide linked diacetylene amphiphiles for detection of epitope specific antibodies |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9762857/ https://www.ncbi.nlm.nih.gov/pubmed/36540572 http://dx.doi.org/10.3390/chemosensors10020062 |
work_keys_str_mv | AT trannatalie peptidelinkeddiacetyleneamphiphilesfordetectionofepitopespecificantibodies AT shiveshwarkarpriyanka peptidelinkeddiacetyleneamphiphilesfordetectionofepitopespecificantibodies AT jaworskijustyn peptidelinkeddiacetyleneamphiphilesfordetectionofepitopespecificantibodies |