Cargando…

Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes

The incident of lipid metabolism disorders has obviously increased under the undue pursuit of efficiency, which had seriously threatened to the health development of poultry industry. As an important cholesterol-derived intermediate, though dehydroepiandrosterone (DHEA) has the fat-reduction effect...

Descripción completa

Detalles Bibliográficos
Autores principales: Yao, Yao, Yang, Ying, Wang, Huihui, Jiang, Zhihao, Ma, Haitian
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9800306/
https://www.ncbi.nlm.nih.gov/pubmed/36565630
http://dx.doi.org/10.1016/j.psj.2022.102385
_version_ 1784861268088193024
author Yao, Yao
Yang, Ying
Wang, Huihui
Jiang, Zhihao
Ma, Haitian
author_facet Yao, Yao
Yang, Ying
Wang, Huihui
Jiang, Zhihao
Ma, Haitian
author_sort Yao, Yao
collection PubMed
description The incident of lipid metabolism disorders has obviously increased under the undue pursuit of efficiency, which had seriously threatened to the health development of poultry industry. As an important cholesterol-derived intermediate, though dehydroepiandrosterone (DHEA) has the fat-reduction effect in animals and humans, but the underlying mechanism still poorly understood. Herein, the present study aimed to investigate the regulatory effects and its molecular mechanism of DHEA on disturbance of lipid metabolism induced by oleic acid (OA) in primary chicken hepatocytes. The hepatocytes were treated with 0, 0.1, 1, 10 μM DHEA for 4 h, and then supplemented with 0 or 0.5 mM OA stimulation for another 24 h. Our findings demonstrated that DHEA treatment effectively reduced TG content and alleviated lipid droplet deposition in OA-induced hepatocytes. DHEA inhibited the lipogenesis related factors (ACC, FAS, SREBP-1c, and ACLY) mRNA level and increased the lipolysis key factors (CPT-1 and PPARα) mRNA levels. In addition, DHEA obviously elevated the protein levels of CPT-1A, p-ACC, and ECHS1; whereas decreased the protein levels of FAS and SREBP-1 in hepatocytes stimulated by OA. Furthermore, DHEA promoted the phosphorylation of AMP-activated protein kinase (AMPK) and inhibited the phosphorylation of mammalian target of rapamycin (mTOR). Mechanistically, the hepatocytes were pre-treated with AMPK inhibitor compound C or AMPK activator AICAR before addition of DHEA treatment, and the results certified that DHEA activated cAMP/AMPK pathway and which subsequently led the inhibition of mTOR signal, which finally reduced the fat excessive accumulation in OA-stimulated hepatocytes. Collectively, our study unveiled that DHEA protects against the lipid metabolism disorders triggered by OA stimulation through activation of AMPK-mTOR signaling pathway, which prompts the value of DHEA as a potential nutritional supplement in regulating the lipid metabolism and its related disease in poultry.
format Online
Article
Text
id pubmed-9800306
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-98003062022-12-31 Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes Yao, Yao Yang, Ying Wang, Huihui Jiang, Zhihao Ma, Haitian Poult Sci METABOLISM AND NUTRITION The incident of lipid metabolism disorders has obviously increased under the undue pursuit of efficiency, which had seriously threatened to the health development of poultry industry. As an important cholesterol-derived intermediate, though dehydroepiandrosterone (DHEA) has the fat-reduction effect in animals and humans, but the underlying mechanism still poorly understood. Herein, the present study aimed to investigate the regulatory effects and its molecular mechanism of DHEA on disturbance of lipid metabolism induced by oleic acid (OA) in primary chicken hepatocytes. The hepatocytes were treated with 0, 0.1, 1, 10 μM DHEA for 4 h, and then supplemented with 0 or 0.5 mM OA stimulation for another 24 h. Our findings demonstrated that DHEA treatment effectively reduced TG content and alleviated lipid droplet deposition in OA-induced hepatocytes. DHEA inhibited the lipogenesis related factors (ACC, FAS, SREBP-1c, and ACLY) mRNA level and increased the lipolysis key factors (CPT-1 and PPARα) mRNA levels. In addition, DHEA obviously elevated the protein levels of CPT-1A, p-ACC, and ECHS1; whereas decreased the protein levels of FAS and SREBP-1 in hepatocytes stimulated by OA. Furthermore, DHEA promoted the phosphorylation of AMP-activated protein kinase (AMPK) and inhibited the phosphorylation of mammalian target of rapamycin (mTOR). Mechanistically, the hepatocytes were pre-treated with AMPK inhibitor compound C or AMPK activator AICAR before addition of DHEA treatment, and the results certified that DHEA activated cAMP/AMPK pathway and which subsequently led the inhibition of mTOR signal, which finally reduced the fat excessive accumulation in OA-stimulated hepatocytes. Collectively, our study unveiled that DHEA protects against the lipid metabolism disorders triggered by OA stimulation through activation of AMPK-mTOR signaling pathway, which prompts the value of DHEA as a potential nutritional supplement in regulating the lipid metabolism and its related disease in poultry. Elsevier 2022-12-06 /pmc/articles/PMC9800306/ /pubmed/36565630 http://dx.doi.org/10.1016/j.psj.2022.102385 Text en © 2022 The Authors https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle METABOLISM AND NUTRITION
Yao, Yao
Yang, Ying
Wang, Huihui
Jiang, Zhihao
Ma, Haitian
Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title_full Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title_fullStr Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title_full_unstemmed Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title_short Dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of AMPK-mTOR signal pathway in primary chicken hepatocytes
title_sort dehydroepiandrosterone alleviates oleic acid-induced lipid metabolism disorders through activation of ampk-mtor signal pathway in primary chicken hepatocytes
topic METABOLISM AND NUTRITION
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9800306/
https://www.ncbi.nlm.nih.gov/pubmed/36565630
http://dx.doi.org/10.1016/j.psj.2022.102385
work_keys_str_mv AT yaoyao dehydroepiandrosteronealleviatesoleicacidinducedlipidmetabolismdisordersthroughactivationofampkmtorsignalpathwayinprimarychickenhepatocytes
AT yangying dehydroepiandrosteronealleviatesoleicacidinducedlipidmetabolismdisordersthroughactivationofampkmtorsignalpathwayinprimarychickenhepatocytes
AT wanghuihui dehydroepiandrosteronealleviatesoleicacidinducedlipidmetabolismdisordersthroughactivationofampkmtorsignalpathwayinprimarychickenhepatocytes
AT jiangzhihao dehydroepiandrosteronealleviatesoleicacidinducedlipidmetabolismdisordersthroughactivationofampkmtorsignalpathwayinprimarychickenhepatocytes
AT mahaitian dehydroepiandrosteronealleviatesoleicacidinducedlipidmetabolismdisordersthroughactivationofampkmtorsignalpathwayinprimarychickenhepatocytes