Cargando…
Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice
INTRODUCTION: Plant height and grain length are important agronomic traits in rice, exhibiting a strong effect on plant architecture and grain quality of rice varieties. METHODS: Methods: A novel rice chromosomal segment substitution line (CSSL), i.e., CSSL-Z1357, with significantly increased plant...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9800928/ https://www.ncbi.nlm.nih.gov/pubmed/36589042 http://dx.doi.org/10.3389/fpls.2022.1020847 |
_version_ | 1784861391874686976 |
---|---|
author | Mao, Zuyuan Di, Xinyan Xia, Saisai Chen, Qian Ma, Xiaohui Chen, Mei Yang, Zhenglin Zhao, Fangming Ling, Yinghua |
author_facet | Mao, Zuyuan Di, Xinyan Xia, Saisai Chen, Qian Ma, Xiaohui Chen, Mei Yang, Zhenglin Zhao, Fangming Ling, Yinghua |
author_sort | Mao, Zuyuan |
collection | PubMed |
description | INTRODUCTION: Plant height and grain length are important agronomic traits in rice, exhibiting a strong effect on plant architecture and grain quality of rice varieties. METHODS: Methods: A novel rice chromosomal segment substitution line (CSSL), i.e., CSSL-Z1357, with significantly increased plant height (PH) and grain length (GL) was identified from CSSLs constructed by using Nipponbare as a receptor and a restorer line Xihui 18 as a donor. Seven agronomic traits of PH, PL, GL, GW, GPP, SPP, and TGW were phenotyped, and REML implemented in HPMIXED of SAS were used to detect the QTL for these traits. Secondary CSSLs were screened out via marker-assisted selection (MAS) to estimate the additive and epistatic effects of detected QTLs, evaluating the potential utilization of pyramiding the target QTLs for yield and quality improvement of rice varieties. RESULTS AND DISCUSSION: Results and Discussion: CSSL-Z1357 carried nine segments from Xihui 18 with an average segment length of 4.13 Mb. The results show that the long grain of CSSL-Z1357 was caused by the increased number of surface cells and the length of the inner glume. Thirteen quantitative trait loci were identified via the F2 population of Nipponbare/CSSL-Z1357, including three each for GL (qGL-3, qGL-6, and qGL-7) and PH (qPH-1, qPH-7, and qPH-12I), among which qGL-3 increased GL by 0.23 mm with synergistic allele from CSSL-Z1357. Additionally, three single (S1 to S3), two double (D1, D2), and one triple segment (T1) substitution lines were developed in F3 via MAS. Results show that pyramiding the segments from Chr.3 (qGL-3 and qPH-3), Chr.6 (qGL-6 and qPH-6), and Chr.7 (Null and qPH-7) tended to result in better phenotype of increased GL and PH and decreased grain width, providing a potential basis for enhancing grain yield and quality in rice breeding. |
format | Online Article Text |
id | pubmed-9800928 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-98009282022-12-31 Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice Mao, Zuyuan Di, Xinyan Xia, Saisai Chen, Qian Ma, Xiaohui Chen, Mei Yang, Zhenglin Zhao, Fangming Ling, Yinghua Front Plant Sci Plant Science INTRODUCTION: Plant height and grain length are important agronomic traits in rice, exhibiting a strong effect on plant architecture and grain quality of rice varieties. METHODS: Methods: A novel rice chromosomal segment substitution line (CSSL), i.e., CSSL-Z1357, with significantly increased plant height (PH) and grain length (GL) was identified from CSSLs constructed by using Nipponbare as a receptor and a restorer line Xihui 18 as a donor. Seven agronomic traits of PH, PL, GL, GW, GPP, SPP, and TGW were phenotyped, and REML implemented in HPMIXED of SAS were used to detect the QTL for these traits. Secondary CSSLs were screened out via marker-assisted selection (MAS) to estimate the additive and epistatic effects of detected QTLs, evaluating the potential utilization of pyramiding the target QTLs for yield and quality improvement of rice varieties. RESULTS AND DISCUSSION: Results and Discussion: CSSL-Z1357 carried nine segments from Xihui 18 with an average segment length of 4.13 Mb. The results show that the long grain of CSSL-Z1357 was caused by the increased number of surface cells and the length of the inner glume. Thirteen quantitative trait loci were identified via the F2 population of Nipponbare/CSSL-Z1357, including three each for GL (qGL-3, qGL-6, and qGL-7) and PH (qPH-1, qPH-7, and qPH-12I), among which qGL-3 increased GL by 0.23 mm with synergistic allele from CSSL-Z1357. Additionally, three single (S1 to S3), two double (D1, D2), and one triple segment (T1) substitution lines were developed in F3 via MAS. Results show that pyramiding the segments from Chr.3 (qGL-3 and qPH-3), Chr.6 (qGL-6 and qPH-6), and Chr.7 (Null and qPH-7) tended to result in better phenotype of increased GL and PH and decreased grain width, providing a potential basis for enhancing grain yield and quality in rice breeding. Frontiers Media S.A. 2022-12-16 /pmc/articles/PMC9800928/ /pubmed/36589042 http://dx.doi.org/10.3389/fpls.2022.1020847 Text en Copyright © 2022 Mao, Di, Xia, Chen, Ma, Chen, Yang, Zhao and Ling https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Plant Science Mao, Zuyuan Di, Xinyan Xia, Saisai Chen, Qian Ma, Xiaohui Chen, Mei Yang, Zhenglin Zhao, Fangming Ling, Yinghua Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title | Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title_full | Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title_fullStr | Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title_full_unstemmed | Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title_short | Detecting and pyramiding target QTL for plant- and grain-related traits via chromosomal segment substitution line of rice |
title_sort | detecting and pyramiding target qtl for plant- and grain-related traits via chromosomal segment substitution line of rice |
topic | Plant Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9800928/ https://www.ncbi.nlm.nih.gov/pubmed/36589042 http://dx.doi.org/10.3389/fpls.2022.1020847 |
work_keys_str_mv | AT maozuyuan detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT dixinyan detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT xiasaisai detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT chenqian detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT maxiaohui detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT chenmei detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT yangzhenglin detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT zhaofangming detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice AT lingyinghua detectingandpyramidingtargetqtlforplantandgrainrelatedtraitsviachromosomalsegmentsubstitutionlineofrice |