Cargando…
Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading
| Autor principal: | |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Oxford University Press
2022
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9806610/ https://www.ncbi.nlm.nih.gov/pubmed/36222568 http://dx.doi.org/10.1093/plphys/kiac475 |
| _version_ | 1784862565089673216 |
|---|---|
| author | Kazachkova, Yana |
| author_facet | Kazachkova, Yana |
| author_sort | Kazachkova, Yana |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-9806610 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2022 |
| publisher | Oxford University Press |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-98066102023-01-03 Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading Kazachkova, Yana Plant Physiol News and Views Oxford University Press 2022-10-12 /pmc/articles/PMC9806610/ /pubmed/36222568 http://dx.doi.org/10.1093/plphys/kiac475 Text en © The Author(s) 2022. Published by Oxford University Press on behalf of American Society of Plant Biologists. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited. |
| spellingShingle | News and Views Kazachkova, Yana Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title | Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title_full | Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title_fullStr | Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title_full_unstemmed | Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title_short | Seeds and heavy metal: Defensin-like protein DEF8 mediates cadmium accumulation in rice and phloem unloading |
| title_sort | seeds and heavy metal: defensin-like protein def8 mediates cadmium accumulation in rice and phloem unloading |
| topic | News and Views |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9806610/ https://www.ncbi.nlm.nih.gov/pubmed/36222568 http://dx.doi.org/10.1093/plphys/kiac475 |
| work_keys_str_mv | AT kazachkovayana seedsandheavymetaldefensinlikeproteindef8mediatescadmiumaccumulationinriceandphloemunloading |