Cargando…
COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccina...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9819717/ https://www.ncbi.nlm.nih.gov/pubmed/36612789 http://dx.doi.org/10.3390/ijerph20010467 |
_version_ | 1784865296832528384 |
---|---|
author | Virgilio, Eleonora Tondo, Giacomo Montabone, Claudia Comi, Cristoforo |
author_facet | Virgilio, Eleonora Tondo, Giacomo Montabone, Claudia Comi, Cristoforo |
author_sort | Virgilio, Eleonora |
collection | PubMed |
description | Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccination has rarely been reported since the introduction of vaccination. Infections and COVID-19 infection have also been reported as possible triggers for a myasthenic crisis. We report a case of new-onset MG after receiving the mRNA COVID-19 vaccination. The patient was a 73-year-old male initially presenting with ocular symptoms and a rapid generalization. We also performed a literature revision of 26 described cases of MG after SARS-CoV-2 immunization. The patients were a majority of males with generalized late-onset MG occurring after the first dose of vaccine, similar to our patient. Only our patient showed a thymoma. Thymic mass and the positivity of AchR antibodies suggest that vaccination might have triggered a subclinical pre-existing MG with symptoms flaring. Clinicians should be aware of possible new-onset MG after COVID-19 vaccination, particularly in at-risk patients. Even though COVID-19 vaccination should be recommended in MG patients, particularly in well-compensated patients. However, more studies need to be performed in the future. |
format | Online Article Text |
id | pubmed-9819717 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-98197172023-01-07 COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature Virgilio, Eleonora Tondo, Giacomo Montabone, Claudia Comi, Cristoforo Int J Environ Res Public Health Case Report Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccination has rarely been reported since the introduction of vaccination. Infections and COVID-19 infection have also been reported as possible triggers for a myasthenic crisis. We report a case of new-onset MG after receiving the mRNA COVID-19 vaccination. The patient was a 73-year-old male initially presenting with ocular symptoms and a rapid generalization. We also performed a literature revision of 26 described cases of MG after SARS-CoV-2 immunization. The patients were a majority of males with generalized late-onset MG occurring after the first dose of vaccine, similar to our patient. Only our patient showed a thymoma. Thymic mass and the positivity of AchR antibodies suggest that vaccination might have triggered a subclinical pre-existing MG with symptoms flaring. Clinicians should be aware of possible new-onset MG after COVID-19 vaccination, particularly in at-risk patients. Even though COVID-19 vaccination should be recommended in MG patients, particularly in well-compensated patients. However, more studies need to be performed in the future. MDPI 2022-12-27 /pmc/articles/PMC9819717/ /pubmed/36612789 http://dx.doi.org/10.3390/ijerph20010467 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Case Report Virgilio, Eleonora Tondo, Giacomo Montabone, Claudia Comi, Cristoforo COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title | COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title_full | COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title_fullStr | COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title_full_unstemmed | COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title_short | COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature |
title_sort | covid-19 vaccination and late-onset myasthenia gravis: a new case report and review of the literature |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9819717/ https://www.ncbi.nlm.nih.gov/pubmed/36612789 http://dx.doi.org/10.3390/ijerph20010467 |
work_keys_str_mv | AT virgilioeleonora covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature AT tondogiacomo covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature AT montaboneclaudia covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature AT comicristoforo covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature |