Cargando…

COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature

Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccina...

Descripción completa

Detalles Bibliográficos
Autores principales: Virgilio, Eleonora, Tondo, Giacomo, Montabone, Claudia, Comi, Cristoforo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9819717/
https://www.ncbi.nlm.nih.gov/pubmed/36612789
http://dx.doi.org/10.3390/ijerph20010467
_version_ 1784865296832528384
author Virgilio, Eleonora
Tondo, Giacomo
Montabone, Claudia
Comi, Cristoforo
author_facet Virgilio, Eleonora
Tondo, Giacomo
Montabone, Claudia
Comi, Cristoforo
author_sort Virgilio, Eleonora
collection PubMed
description Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccination has rarely been reported since the introduction of vaccination. Infections and COVID-19 infection have also been reported as possible triggers for a myasthenic crisis. We report a case of new-onset MG after receiving the mRNA COVID-19 vaccination. The patient was a 73-year-old male initially presenting with ocular symptoms and a rapid generalization. We also performed a literature revision of 26 described cases of MG after SARS-CoV-2 immunization. The patients were a majority of males with generalized late-onset MG occurring after the first dose of vaccine, similar to our patient. Only our patient showed a thymoma. Thymic mass and the positivity of AchR antibodies suggest that vaccination might have triggered a subclinical pre-existing MG with symptoms flaring. Clinicians should be aware of possible new-onset MG after COVID-19 vaccination, particularly in at-risk patients. Even though COVID-19 vaccination should be recommended in MG patients, particularly in well-compensated patients. However, more studies need to be performed in the future.
format Online
Article
Text
id pubmed-9819717
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-98197172023-01-07 COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature Virgilio, Eleonora Tondo, Giacomo Montabone, Claudia Comi, Cristoforo Int J Environ Res Public Health Case Report Myasthenia gravis (MG) is a rare autoimmune disease that is potentially threatening for patient life. Auto-antibodies targeting structures of the neuromuscular junction, particularly the acetylcholine receptor (AchR), are often found in the serum of MG patients. New-onset MG after SARS-CoV-2 vaccination has rarely been reported since the introduction of vaccination. Infections and COVID-19 infection have also been reported as possible triggers for a myasthenic crisis. We report a case of new-onset MG after receiving the mRNA COVID-19 vaccination. The patient was a 73-year-old male initially presenting with ocular symptoms and a rapid generalization. We also performed a literature revision of 26 described cases of MG after SARS-CoV-2 immunization. The patients were a majority of males with generalized late-onset MG occurring after the first dose of vaccine, similar to our patient. Only our patient showed a thymoma. Thymic mass and the positivity of AchR antibodies suggest that vaccination might have triggered a subclinical pre-existing MG with symptoms flaring. Clinicians should be aware of possible new-onset MG after COVID-19 vaccination, particularly in at-risk patients. Even though COVID-19 vaccination should be recommended in MG patients, particularly in well-compensated patients. However, more studies need to be performed in the future. MDPI 2022-12-27 /pmc/articles/PMC9819717/ /pubmed/36612789 http://dx.doi.org/10.3390/ijerph20010467 Text en © 2022 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Case Report
Virgilio, Eleonora
Tondo, Giacomo
Montabone, Claudia
Comi, Cristoforo
COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title_full COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title_fullStr COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title_full_unstemmed COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title_short COVID-19 Vaccination and Late-Onset Myasthenia Gravis: A New Case Report and Review of the Literature
title_sort covid-19 vaccination and late-onset myasthenia gravis: a new case report and review of the literature
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9819717/
https://www.ncbi.nlm.nih.gov/pubmed/36612789
http://dx.doi.org/10.3390/ijerph20010467
work_keys_str_mv AT virgilioeleonora covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature
AT tondogiacomo covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature
AT montaboneclaudia covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature
AT comicristoforo covid19vaccinationandlateonsetmyastheniagravisanewcasereportandreviewoftheliterature