Cargando…

Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review

BACKGROUND: Constitutional mismatch repair deficiency (CMMRD) results from a biallelic germline pathogenic variant in a mismatch repair (MMR) gene. The most common CMMRD-associated malignancies are brain tumors; an accurate diagnosis is challenging when a malignant brain tumor is the only tumor at p...

Descripción completa

Detalles Bibliográficos
Autores principales: Onishi, Shumpei, Yamasaki, Fumiyuki, Kuraoka, Kazuya, Taguchi, Akira, Takayasu, Takeshi, Akagi, Kiwamu, Hinoi, Takao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9843912/
https://www.ncbi.nlm.nih.gov/pubmed/36647049
http://dx.doi.org/10.1186/s12920-022-01403-9
_version_ 1784870503307018240
author Onishi, Shumpei
Yamasaki, Fumiyuki
Kuraoka, Kazuya
Taguchi, Akira
Takayasu, Takeshi
Akagi, Kiwamu
Hinoi, Takao
author_facet Onishi, Shumpei
Yamasaki, Fumiyuki
Kuraoka, Kazuya
Taguchi, Akira
Takayasu, Takeshi
Akagi, Kiwamu
Hinoi, Takao
author_sort Onishi, Shumpei
collection PubMed
description BACKGROUND: Constitutional mismatch repair deficiency (CMMRD) results from a biallelic germline pathogenic variant in a mismatch repair (MMR) gene. The most common CMMRD-associated malignancies are brain tumors; an accurate diagnosis is challenging when a malignant brain tumor is the only tumor at presentation. We describe two cases of glioblastoma as the initial CMMRD malignancy and discuss current diagnostic and therapeutic challenges. CASE PRESENTATION: Two children with brain tumors without remarkable family history had biallelic pathogenic germline variants in PMS2. Patient 1: A 6-year-old girl presented biallelic PMS2 germline pathogenic variants. Glioblastomas at the left frontal lobe and right temporal lobe were resistant to immune-checkpoint inhibitor, temozolomide, and bevacizumab. Patient 2: A 10-year-old boy presented biallelic PMS2 germline variants. His glioblastoma with primitive neuroectodermal tumor-like features responded to chemoradiotherapy, but he developed advanced colon cancer and acute lymphocytic leukemia. In both patients, only a monoallelic PMS2 germline variant was detected by conventional gene tests. PMS2 immunohistochemistry showed lack of staining at both the tumors and normal tissue as vascular endothelial cells. Further gene tests revealed large genomic deletion including the entire PMS2 gene, confirming biallelic PMS2 germline variants. CONCLUSION: Conventional multi-gene panel tests are insufficient for detecting large deletions of MMR genes, resulting in misdiagnoses of CMMRD as Lynch syndrome. PMS2 variants have low cancer penetrance; family histories may thus be absent. Long-range gene analyses or immunohistochemical staining of MMR proteins in normal tissue should be considered for pediatric brain tumors with a single allele MMR variant when CMMRD is suspected. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-022-01403-9.
format Online
Article
Text
id pubmed-9843912
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-98439122023-01-18 Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review Onishi, Shumpei Yamasaki, Fumiyuki Kuraoka, Kazuya Taguchi, Akira Takayasu, Takeshi Akagi, Kiwamu Hinoi, Takao BMC Med Genomics Case Report BACKGROUND: Constitutional mismatch repair deficiency (CMMRD) results from a biallelic germline pathogenic variant in a mismatch repair (MMR) gene. The most common CMMRD-associated malignancies are brain tumors; an accurate diagnosis is challenging when a malignant brain tumor is the only tumor at presentation. We describe two cases of glioblastoma as the initial CMMRD malignancy and discuss current diagnostic and therapeutic challenges. CASE PRESENTATION: Two children with brain tumors without remarkable family history had biallelic pathogenic germline variants in PMS2. Patient 1: A 6-year-old girl presented biallelic PMS2 germline pathogenic variants. Glioblastomas at the left frontal lobe and right temporal lobe were resistant to immune-checkpoint inhibitor, temozolomide, and bevacizumab. Patient 2: A 10-year-old boy presented biallelic PMS2 germline variants. His glioblastoma with primitive neuroectodermal tumor-like features responded to chemoradiotherapy, but he developed advanced colon cancer and acute lymphocytic leukemia. In both patients, only a monoallelic PMS2 germline variant was detected by conventional gene tests. PMS2 immunohistochemistry showed lack of staining at both the tumors and normal tissue as vascular endothelial cells. Further gene tests revealed large genomic deletion including the entire PMS2 gene, confirming biallelic PMS2 germline variants. CONCLUSION: Conventional multi-gene panel tests are insufficient for detecting large deletions of MMR genes, resulting in misdiagnoses of CMMRD as Lynch syndrome. PMS2 variants have low cancer penetrance; family histories may thus be absent. Long-range gene analyses or immunohistochemical staining of MMR proteins in normal tissue should be considered for pediatric brain tumors with a single allele MMR variant when CMMRD is suspected. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12920-022-01403-9. BioMed Central 2023-01-16 /pmc/articles/PMC9843912/ /pubmed/36647049 http://dx.doi.org/10.1186/s12920-022-01403-9 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Case Report
Onishi, Shumpei
Yamasaki, Fumiyuki
Kuraoka, Kazuya
Taguchi, Akira
Takayasu, Takeshi
Akagi, Kiwamu
Hinoi, Takao
Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title_full Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title_fullStr Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title_full_unstemmed Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title_short Diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (CMMRD): two case reports and a literature review
title_sort diagnostic and therapeutic challenges of glioblastoma as an initial malignancy of constitutional mismatch repair deficiency (cmmrd): two case reports and a literature review
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9843912/
https://www.ncbi.nlm.nih.gov/pubmed/36647049
http://dx.doi.org/10.1186/s12920-022-01403-9
work_keys_str_mv AT onishishumpei diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT yamasakifumiyuki diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT kuraokakazuya diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT taguchiakira diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT takayasutakeshi diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT akagikiwamu diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview
AT hinoitakao diagnosticandtherapeuticchallengesofglioblastomaasaninitialmalignancyofconstitutionalmismatchrepairdeficiencycmmrdtwocasereportsandaliteraturereview