Cargando…
Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors
Among its many molecular targets, the ubiquitous calcium sensor protein calmodulin (CaM) recognizes and regulates the activity of ryanodine receptors type 1 (RyR1) and 2 (RyR2), mainly expressed in skeletal and cardiac muscle, respectively. Such regulation is essential to achieve controlled contract...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9849693/ https://www.ncbi.nlm.nih.gov/pubmed/36685279 http://dx.doi.org/10.3389/fmolb.2022.1100992 |
_version_ | 1784872007066714112 |
---|---|
author | Dal Cortivo, Giuditta Marino, Valerio Bianconi, Silvia Dell'Orco, Daniele |
author_facet | Dal Cortivo, Giuditta Marino, Valerio Bianconi, Silvia Dell'Orco, Daniele |
author_sort | Dal Cortivo, Giuditta |
collection | PubMed |
description | Among its many molecular targets, the ubiquitous calcium sensor protein calmodulin (CaM) recognizes and regulates the activity of ryanodine receptors type 1 (RyR1) and 2 (RyR2), mainly expressed in skeletal and cardiac muscle, respectively. Such regulation is essential to achieve controlled contraction of muscle cells. To unravel the molecular mechanisms underlying the target recognition process, we conducted a comprehensive biophysical investigation of the interaction between two calmodulin variants associated with congenital arrhythmia, namely N97I and Q135P, and a highly conserved calmodulin-binding region in RyR1 and RyR2. The structural, thermodynamic, and kinetic properties of protein-peptide interactions were assessed together with an in-depth structural and topological investigation based on molecular dynamics simulations. This integrated approach allowed us to identify amino acids that are crucial in mediating allosteric processes, which enable high selectivity in molecular target recognition. Our results suggest that the ability of calmodulin to discriminate between RyR1 an RyR2 targets depends on kinetic discrimination and robust allosteric communication between Ca(2+)-binding sites (EF1-EF3 and EF3-EF4 pairs), which is perturbed in both N97I and Q135P arrhythmia-associated variants. |
format | Online Article Text |
id | pubmed-9849693 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-98496932023-01-20 Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors Dal Cortivo, Giuditta Marino, Valerio Bianconi, Silvia Dell'Orco, Daniele Front Mol Biosci Molecular Biosciences Among its many molecular targets, the ubiquitous calcium sensor protein calmodulin (CaM) recognizes and regulates the activity of ryanodine receptors type 1 (RyR1) and 2 (RyR2), mainly expressed in skeletal and cardiac muscle, respectively. Such regulation is essential to achieve controlled contraction of muscle cells. To unravel the molecular mechanisms underlying the target recognition process, we conducted a comprehensive biophysical investigation of the interaction between two calmodulin variants associated with congenital arrhythmia, namely N97I and Q135P, and a highly conserved calmodulin-binding region in RyR1 and RyR2. The structural, thermodynamic, and kinetic properties of protein-peptide interactions were assessed together with an in-depth structural and topological investigation based on molecular dynamics simulations. This integrated approach allowed us to identify amino acids that are crucial in mediating allosteric processes, which enable high selectivity in molecular target recognition. Our results suggest that the ability of calmodulin to discriminate between RyR1 an RyR2 targets depends on kinetic discrimination and robust allosteric communication between Ca(2+)-binding sites (EF1-EF3 and EF3-EF4 pairs), which is perturbed in both N97I and Q135P arrhythmia-associated variants. Frontiers Media S.A. 2023-01-05 /pmc/articles/PMC9849693/ /pubmed/36685279 http://dx.doi.org/10.3389/fmolb.2022.1100992 Text en Copyright © 2023 Dal Cortivo, Marino, Bianconi and Dell’Orco. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Molecular Biosciences Dal Cortivo, Giuditta Marino, Valerio Bianconi, Silvia Dell'Orco, Daniele Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title | Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title_full | Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title_fullStr | Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title_full_unstemmed | Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title_short | Calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
title_sort | calmodulin variants associated with congenital arrhythmia impair selectivity for ryanodine receptors |
topic | Molecular Biosciences |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9849693/ https://www.ncbi.nlm.nih.gov/pubmed/36685279 http://dx.doi.org/10.3389/fmolb.2022.1100992 |
work_keys_str_mv | AT dalcortivogiuditta calmodulinvariantsassociatedwithcongenitalarrhythmiaimpairselectivityforryanodinereceptors AT marinovalerio calmodulinvariantsassociatedwithcongenitalarrhythmiaimpairselectivityforryanodinereceptors AT bianconisilvia calmodulinvariantsassociatedwithcongenitalarrhythmiaimpairselectivityforryanodinereceptors AT dellorcodaniele calmodulinvariantsassociatedwithcongenitalarrhythmiaimpairselectivityforryanodinereceptors |