Cargando…
Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects th...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9863640/ https://www.ncbi.nlm.nih.gov/pubmed/36675287 http://dx.doi.org/10.3390/ijms24021771 |
_version_ | 1784875384620187648 |
---|---|
author | He, Qifu Gao, Feng Wu, Shenghui Wang, Shaowen Xu, Zhiming Xu, Xuerui Lan, Tianyang Zhang, Kang Quan, Fusheng |
author_facet | He, Qifu Gao, Feng Wu, Shenghui Wang, Shaowen Xu, Zhiming Xu, Xuerui Lan, Tianyang Zhang, Kang Quan, Fusheng |
author_sort | He, Qifu |
collection | PubMed |
description | In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects the motility of X-chromosome-bearing sperm remains unclear. In this study, we explored this mechanism by incubating dairy goat sperm in alkaline dilutions, examining the pattern of changes in sperm internal pH and Ca(2+) concentrations and investigating the role of the sAC/cAMP/PKA pathway in influencing sperm motility. The results showed that adding a calcium channel inhibitor during incubation resulted in a concentration-dependent decrease in the proportion of spermatozoa with forward motility, and the sperm sAC protein activity was positively correlated with the calcium ion concentration (r = 0.9972). The total motility activity, proportion of forward motility, and proportion of X-chromosome-bearing sperm decreased (p < 0.05) when cAMP/PKA protease activity was inhibited. Meanwhile, the enrichment of X-chromosome-bearing sperm by pH did not affect the sperm capacitation state. These results indicate that alkaline dilution incubation reduces Ca(2+) entry into X-sperm and the motility was slowed down through the sAC/cAMP/PKA signaling pathway, providing a theoretical foundation for further optimization of the sex control method. |
format | Online Article Text |
id | pubmed-9863640 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-98636402023-01-22 Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity He, Qifu Gao, Feng Wu, Shenghui Wang, Shaowen Xu, Zhiming Xu, Xuerui Lan, Tianyang Zhang, Kang Quan, Fusheng Int J Mol Sci Article In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects the motility of X-chromosome-bearing sperm remains unclear. In this study, we explored this mechanism by incubating dairy goat sperm in alkaline dilutions, examining the pattern of changes in sperm internal pH and Ca(2+) concentrations and investigating the role of the sAC/cAMP/PKA pathway in influencing sperm motility. The results showed that adding a calcium channel inhibitor during incubation resulted in a concentration-dependent decrease in the proportion of spermatozoa with forward motility, and the sperm sAC protein activity was positively correlated with the calcium ion concentration (r = 0.9972). The total motility activity, proportion of forward motility, and proportion of X-chromosome-bearing sperm decreased (p < 0.05) when cAMP/PKA protease activity was inhibited. Meanwhile, the enrichment of X-chromosome-bearing sperm by pH did not affect the sperm capacitation state. These results indicate that alkaline dilution incubation reduces Ca(2+) entry into X-sperm and the motility was slowed down through the sAC/cAMP/PKA signaling pathway, providing a theoretical foundation for further optimization of the sex control method. MDPI 2023-01-16 /pmc/articles/PMC9863640/ /pubmed/36675287 http://dx.doi.org/10.3390/ijms24021771 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article He, Qifu Gao, Feng Wu, Shenghui Wang, Shaowen Xu, Zhiming Xu, Xuerui Lan, Tianyang Zhang, Kang Quan, Fusheng Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title | Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title_full | Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title_fullStr | Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title_full_unstemmed | Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title_short | Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity |
title_sort | alkaline dilution alters sperm motility in dairy goat by affecting sac/camp/pka pathway activity |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9863640/ https://www.ncbi.nlm.nih.gov/pubmed/36675287 http://dx.doi.org/10.3390/ijms24021771 |
work_keys_str_mv | AT heqifu alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT gaofeng alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT wushenghui alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT wangshaowen alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT xuzhiming alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT xuxuerui alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT lantianyang alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT zhangkang alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity AT quanfusheng alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity |