Cargando…

Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity

In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects th...

Descripción completa

Detalles Bibliográficos
Autores principales: He, Qifu, Gao, Feng, Wu, Shenghui, Wang, Shaowen, Xu, Zhiming, Xu, Xuerui, Lan, Tianyang, Zhang, Kang, Quan, Fusheng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9863640/
https://www.ncbi.nlm.nih.gov/pubmed/36675287
http://dx.doi.org/10.3390/ijms24021771
_version_ 1784875384620187648
author He, Qifu
Gao, Feng
Wu, Shenghui
Wang, Shaowen
Xu, Zhiming
Xu, Xuerui
Lan, Tianyang
Zhang, Kang
Quan, Fusheng
author_facet He, Qifu
Gao, Feng
Wu, Shenghui
Wang, Shaowen
Xu, Zhiming
Xu, Xuerui
Lan, Tianyang
Zhang, Kang
Quan, Fusheng
author_sort He, Qifu
collection PubMed
description In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects the motility of X-chromosome-bearing sperm remains unclear. In this study, we explored this mechanism by incubating dairy goat sperm in alkaline dilutions, examining the pattern of changes in sperm internal pH and Ca(2+) concentrations and investigating the role of the sAC/cAMP/PKA pathway in influencing sperm motility. The results showed that adding a calcium channel inhibitor during incubation resulted in a concentration-dependent decrease in the proportion of spermatozoa with forward motility, and the sperm sAC protein activity was positively correlated with the calcium ion concentration (r = 0.9972). The total motility activity, proportion of forward motility, and proportion of X-chromosome-bearing sperm decreased (p < 0.05) when cAMP/PKA protease activity was inhibited. Meanwhile, the enrichment of X-chromosome-bearing sperm by pH did not affect the sperm capacitation state. These results indicate that alkaline dilution incubation reduces Ca(2+) entry into X-sperm and the motility was slowed down through the sAC/cAMP/PKA signaling pathway, providing a theoretical foundation for further optimization of the sex control method.
format Online
Article
Text
id pubmed-9863640
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-98636402023-01-22 Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity He, Qifu Gao, Feng Wu, Shenghui Wang, Shaowen Xu, Zhiming Xu, Xuerui Lan, Tianyang Zhang, Kang Quan, Fusheng Int J Mol Sci Article In dairy goat farming, increasing the female kid rate is beneficial to milk production and is, therefore, economically beneficial to farms. Our previous study demonstrated that alkaline incubation enriched the concentration of X-chromosome-bearing sperm; however, the mechanism by which pH affects the motility of X-chromosome-bearing sperm remains unclear. In this study, we explored this mechanism by incubating dairy goat sperm in alkaline dilutions, examining the pattern of changes in sperm internal pH and Ca(2+) concentrations and investigating the role of the sAC/cAMP/PKA pathway in influencing sperm motility. The results showed that adding a calcium channel inhibitor during incubation resulted in a concentration-dependent decrease in the proportion of spermatozoa with forward motility, and the sperm sAC protein activity was positively correlated with the calcium ion concentration (r = 0.9972). The total motility activity, proportion of forward motility, and proportion of X-chromosome-bearing sperm decreased (p < 0.05) when cAMP/PKA protease activity was inhibited. Meanwhile, the enrichment of X-chromosome-bearing sperm by pH did not affect the sperm capacitation state. These results indicate that alkaline dilution incubation reduces Ca(2+) entry into X-sperm and the motility was slowed down through the sAC/cAMP/PKA signaling pathway, providing a theoretical foundation for further optimization of the sex control method. MDPI 2023-01-16 /pmc/articles/PMC9863640/ /pubmed/36675287 http://dx.doi.org/10.3390/ijms24021771 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
He, Qifu
Gao, Feng
Wu, Shenghui
Wang, Shaowen
Xu, Zhiming
Xu, Xuerui
Lan, Tianyang
Zhang, Kang
Quan, Fusheng
Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title_full Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title_fullStr Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title_full_unstemmed Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title_short Alkaline Dilution Alters Sperm Motility in Dairy Goat by Affecting sAC/cAMP/PKA Pathway Activity
title_sort alkaline dilution alters sperm motility in dairy goat by affecting sac/camp/pka pathway activity
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9863640/
https://www.ncbi.nlm.nih.gov/pubmed/36675287
http://dx.doi.org/10.3390/ijms24021771
work_keys_str_mv AT heqifu alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT gaofeng alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT wushenghui alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT wangshaowen alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT xuzhiming alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT xuxuerui alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT lantianyang alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT zhangkang alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity
AT quanfusheng alkalinedilutionaltersspermmotilityindairygoatbyaffectingsaccamppkapathwayactivity