Cargando…
Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS)
AIMS: Wild‐type transthyretin cardiac amyloidosis (ATTRwt) is an infiltrative cardiomyopathy with a poor prognosis. The condition is associated with carpal tunnel syndrome (CTS), which often precedes the ATTRwt diagnosis by several years. The aim of the study was (i) to screen patients with a recent...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9871677/ https://www.ncbi.nlm.nih.gov/pubmed/36193570 http://dx.doi.org/10.1002/ehf2.14173 |
_version_ | 1784877231427813376 |
---|---|
author | Ladefoged, Bertil Clemmensen, Tor Dybro, Anne Hartig‐Andreasen, Charlotte Kirkeby, Lone Gormsen, Lars Christian Bomholt, Peter Gillmore, Julian Poulsen, Steen Hvitfeldt |
author_facet | Ladefoged, Bertil Clemmensen, Tor Dybro, Anne Hartig‐Andreasen, Charlotte Kirkeby, Lone Gormsen, Lars Christian Bomholt, Peter Gillmore, Julian Poulsen, Steen Hvitfeldt |
author_sort | Ladefoged, Bertil |
collection | PubMed |
description | AIMS: Wild‐type transthyretin cardiac amyloidosis (ATTRwt) is an infiltrative cardiomyopathy with a poor prognosis. The condition is associated with carpal tunnel syndrome (CTS), which often precedes the ATTRwt diagnosis by several years. The aim of the study was (i) to screen patients with a recent history of CTS for ATTRwt using red flags, (ii) to determine whether patients with screened ATTRwt had less advanced disease compared with patients with clinical ATTRwt, and (iii) to assess the sensitivity and specificity of known red flags in ATTRwt. METHODS AND RESULTS: Patients aged ≥60 years at the time of CTS surgery were invited for screening. Red flags were defined as elevated biomarker levels of N‐terminal pro‐B‐type natriuretic peptide (NT‐proBNP) or cardiac troponin, an electrocardiogram pattern associated with ATTRwt, left ventricular hypertrophy (LVH), and impaired longitudinal strain with apical sparring. All patients with a red flag were referred for a diagnostic scintigraphy. Patients with ATTRwt diagnosed by screening were compared with patients with clinical ATTRwt (n = 51) matched by age, gender, and CTS surgery. Among the 120 enrolled subjects (mean age 74.5 years, 90% male), the suspicion of ATTR was raised in 67 (55.8%), and 10 (8.3%) were diagnosed with ATTRwt. Patients identified with ATTRwt were predominantly asymptomatic and had mildly elevated NT‐proBNP, mildly increased LVH, preserved left ventricular ejection fraction, and systolic longitudinal function, which differed significantly from clinical ATTRwt controls (P < 0.001). CONCLUSIONS: The study found an ATTRwt prevalence of 8.3% in a population of age and gender‐selected patients with a recent history of CTS. The identified patients with ATTRwt had less structural and functional cardiac involvement than clinical ATTRwt controls. |
format | Online Article Text |
id | pubmed-9871677 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-98716772023-01-25 Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) Ladefoged, Bertil Clemmensen, Tor Dybro, Anne Hartig‐Andreasen, Charlotte Kirkeby, Lone Gormsen, Lars Christian Bomholt, Peter Gillmore, Julian Poulsen, Steen Hvitfeldt ESC Heart Fail Original Articles AIMS: Wild‐type transthyretin cardiac amyloidosis (ATTRwt) is an infiltrative cardiomyopathy with a poor prognosis. The condition is associated with carpal tunnel syndrome (CTS), which often precedes the ATTRwt diagnosis by several years. The aim of the study was (i) to screen patients with a recent history of CTS for ATTRwt using red flags, (ii) to determine whether patients with screened ATTRwt had less advanced disease compared with patients with clinical ATTRwt, and (iii) to assess the sensitivity and specificity of known red flags in ATTRwt. METHODS AND RESULTS: Patients aged ≥60 years at the time of CTS surgery were invited for screening. Red flags were defined as elevated biomarker levels of N‐terminal pro‐B‐type natriuretic peptide (NT‐proBNP) or cardiac troponin, an electrocardiogram pattern associated with ATTRwt, left ventricular hypertrophy (LVH), and impaired longitudinal strain with apical sparring. All patients with a red flag were referred for a diagnostic scintigraphy. Patients with ATTRwt diagnosed by screening were compared with patients with clinical ATTRwt (n = 51) matched by age, gender, and CTS surgery. Among the 120 enrolled subjects (mean age 74.5 years, 90% male), the suspicion of ATTR was raised in 67 (55.8%), and 10 (8.3%) were diagnosed with ATTRwt. Patients identified with ATTRwt were predominantly asymptomatic and had mildly elevated NT‐proBNP, mildly increased LVH, preserved left ventricular ejection fraction, and systolic longitudinal function, which differed significantly from clinical ATTRwt controls (P < 0.001). CONCLUSIONS: The study found an ATTRwt prevalence of 8.3% in a population of age and gender‐selected patients with a recent history of CTS. The identified patients with ATTRwt had less structural and functional cardiac involvement than clinical ATTRwt controls. John Wiley and Sons Inc. 2022-10-03 /pmc/articles/PMC9871677/ /pubmed/36193570 http://dx.doi.org/10.1002/ehf2.14173 Text en © 2022 The Authors. ESC Heart Failure published by John Wiley & Sons Ltd on behalf of European Society of Cardiology. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc-nd/4.0/ (https://creativecommons.org/licenses/by-nc-nd/4.0/) License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made. |
spellingShingle | Original Articles Ladefoged, Bertil Clemmensen, Tor Dybro, Anne Hartig‐Andreasen, Charlotte Kirkeby, Lone Gormsen, Lars Christian Bomholt, Peter Gillmore, Julian Poulsen, Steen Hvitfeldt Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title | Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title_full | Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title_fullStr | Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title_full_unstemmed | Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title_short | Identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (CACTuS) |
title_sort | identification of wild‐type transthyretin cardiac amyloidosis in patients with carpal tunnel syndrome surgery (cactus) |
topic | Original Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9871677/ https://www.ncbi.nlm.nih.gov/pubmed/36193570 http://dx.doi.org/10.1002/ehf2.14173 |
work_keys_str_mv | AT ladefogedbertil identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT clemmensentor identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT dybroanne identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT hartigandreasencharlotte identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT kirkebylone identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT gormsenlarschristian identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT bomholtpeter identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT gillmorejulian identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus AT poulsensteenhvitfeldt identificationofwildtypetransthyretincardiacamyloidosisinpatientswithcarpaltunnelsyndromesurgerycactus |