Lumpy skin disease: A newly emerging disease in Southeast Asia

Lumpy skin disease (LSD) is caused by LSD virus (LSDV). This virus has been classified in the genus Capripoxvirus, family Poxviridae which generally affects large ruminants, especially cattle and domestic water buffalo. The first outbreak of LSD was found in 1929 in Zambia, then spreading throughout...

Descripción completa

Detalles Bibliográficos
Autores principales: Ratyotha, Kanokwan, Prakobwong, Suksanti, Piratae, Supawadee
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Veterinary World 2022
Materias:
Review Article
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9880836/
https://www.ncbi.nlm.nih.gov/pubmed/36718323
http://dx.doi.org/10.14202/vetworld.2022.2764-2771
_version_ 1784878982718554112
author Ratyotha, Kanokwan
Prakobwong, Suksanti
Piratae, Supawadee
author_facet Ratyotha, Kanokwan
Prakobwong, Suksanti
Piratae, Supawadee
author_sort Ratyotha, Kanokwan
collection PubMed
description Lumpy skin disease (LSD) is caused by LSD virus (LSDV). This virus has been classified in the genus Capripoxvirus, family Poxviridae which generally affects large ruminants, especially cattle and domestic water buffalo. The first outbreak of LSD was found in 1929 in Zambia, then spreading throughout Africa and with an ongoing expanding distribution to Asia and Europe. In 2020, LSD was found from Southeast Asia in Vietnam and Myanmar before reaching Thailand and Laos in 2021. Therefore, LSD is a newly emerging disease that occurs in Southeast Asia and needs more research about pathology, transmission, diagnosis, distribution, prevention, and control. The results from this review show the nature of LSD, distribution, and epidemic maps which are helpful for further information on the control and prevention of LSD.
format Online
Article
Text
id pubmed-9880836
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Veterinary World
record_format MEDLINE/PubMed
spelling pubmed-98808362023-01-29 Lumpy skin disease: A newly emerging disease in Southeast Asia Ratyotha, Kanokwan Prakobwong, Suksanti Piratae, Supawadee Vet World Review Article Lumpy skin disease (LSD) is caused by LSD virus (LSDV). This virus has been classified in the genus Capripoxvirus, family Poxviridae which generally affects large ruminants, especially cattle and domestic water buffalo. The first outbreak of LSD was found in 1929 in Zambia, then spreading throughout Africa and with an ongoing expanding distribution to Asia and Europe. In 2020, LSD was found from Southeast Asia in Vietnam and Myanmar before reaching Thailand and Laos in 2021. Therefore, LSD is a newly emerging disease that occurs in Southeast Asia and needs more research about pathology, transmission, diagnosis, distribution, prevention, and control. The results from this review show the nature of LSD, distribution, and epidemic maps which are helpful for further information on the control and prevention of LSD. Veterinary World 2022-12 2022-12-05 /pmc/articles/PMC9880836/ /pubmed/36718323 http://dx.doi.org/10.14202/vetworld.2022.2764-2771 Text en Copyright: © Ratyotha, et al. https://creativecommons.org/licenses/by/4.0/Open Access. This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review Article
Ratyotha, Kanokwan
Prakobwong, Suksanti
Piratae, Supawadee
Lumpy skin disease: A newly emerging disease in Southeast Asia
title Lumpy skin disease: A newly emerging disease in Southeast Asia
title_full Lumpy skin disease: A newly emerging disease in Southeast Asia
title_fullStr Lumpy skin disease: A newly emerging disease in Southeast Asia
title_full_unstemmed Lumpy skin disease: A newly emerging disease in Southeast Asia
title_short Lumpy skin disease: A newly emerging disease in Southeast Asia
title_sort lumpy skin disease: a newly emerging disease in southeast asia
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9880836/
https://www.ncbi.nlm.nih.gov/pubmed/36718323
http://dx.doi.org/10.14202/vetworld.2022.2764-2771
work_keys_str_mv AT ratyothakanokwan lumpyskindiseaseanewlyemergingdiseaseinsoutheastasia
AT prakobwongsuksanti lumpyskindiseaseanewlyemergingdiseaseinsoutheastasia
AT pirataesupawadee lumpyskindiseaseanewlyemergingdiseaseinsoutheastasia

Ejemplares similares