Cargando…

Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus

BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosi...

Descripción completa

Detalles Bibliográficos
Autores principales: Faustini, Francesca, Idborg, Helena, Fuzzi, Enrico, Larsson, Anders, Lie, Wen-Rong, Pötzsch, Sven, Okitsu, Shinji L, Svenungsson, Elisabet, Gunnarsson, Iva
Formato: Online Artículo Texto
Lenguaje:English
Publicado: SAGE Publications 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9939930/
https://www.ncbi.nlm.nih.gov/pubmed/36508734
http://dx.doi.org/10.1177/09612033221145534
_version_ 1784890971642658816
author Faustini, Francesca
Idborg, Helena
Fuzzi, Enrico
Larsson, Anders
Lie, Wen-Rong
Pötzsch, Sven
Okitsu, Shinji L
Svenungsson, Elisabet
Gunnarsson, Iva
author_facet Faustini, Francesca
Idborg, Helena
Fuzzi, Enrico
Larsson, Anders
Lie, Wen-Rong
Pötzsch, Sven
Okitsu, Shinji L
Svenungsson, Elisabet
Gunnarsson, Iva
author_sort Faustini, Francesca
collection PubMed
description BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosis and management. OBJECTIVE: To investigate the role of urinary galectin-3 binding protein (u-Gal-3BP) as a candidate biomarker of renal disease in biopsy proven LN. PATIENTS AND METHODS: Levels of u-Gal-3BP were investigated in a cross-sectional fashion by ELISA in 270 subjects: 86 LN patients, 63 active SLE patients with no kidney involvement, 73 SLE patients with inactive disease and 48 age and sex-matched population-based controls (PBC). Moreover, urine samples were analysed separately by ELISA for additional markers of kidney pathology: neutrophil gelatinase-associated lipocalin (NGAL), osteopontin (OPN), kidney injury molecule-1 (KIM-1) and galectin-3 (Gal-3). The concentrations of all studied molecules were normalized to urine creatinine levels. In 10 patients, post-treatment levels of the biomarkers were measured. RESULTS: Normalized u-Gal-3BP levels were higher in LN patients compared to the other groups (p < .0001). Comparing different LN classes, u-Gal-3BP levels were higher among patients with proliferative (class III/IV) and membranous (class V) as compared to mesangial (class II) forms (p = .04). In proliferative forms, u-Gal-3BP levels correlated with the activity index in renal biopsies (r = 0.42, p = .004). Moreover, in a subset of 10 patients with repeated kidney biopsy and urine sampling before and after induction treatment, a significant decrease of u-Gal-3BP was observed (p = .03). Among the other markers, KIM-1 was also able to discriminate LN from the other groups, while NGAL, OPN and Gal-3 could not in this cohort. CONCLUSION: Given its ability to discriminate LN patients from active non-renal and inactive SLE patients, the observed correlation with the activity index in renal biopsies, and its levels declining following treatment, u-Gal-3BP shows promise as a non-invasive urinary biomarker to help detecting and to monitor renal involvement in SLE patients and should be validated in larger cohorts.
format Online
Article
Text
id pubmed-9939930
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher SAGE Publications
record_format MEDLINE/PubMed
spelling pubmed-99399302023-02-21 Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus Faustini, Francesca Idborg, Helena Fuzzi, Enrico Larsson, Anders Lie, Wen-Rong Pötzsch, Sven Okitsu, Shinji L Svenungsson, Elisabet Gunnarsson, Iva Lupus Papers BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosis and management. OBJECTIVE: To investigate the role of urinary galectin-3 binding protein (u-Gal-3BP) as a candidate biomarker of renal disease in biopsy proven LN. PATIENTS AND METHODS: Levels of u-Gal-3BP were investigated in a cross-sectional fashion by ELISA in 270 subjects: 86 LN patients, 63 active SLE patients with no kidney involvement, 73 SLE patients with inactive disease and 48 age and sex-matched population-based controls (PBC). Moreover, urine samples were analysed separately by ELISA for additional markers of kidney pathology: neutrophil gelatinase-associated lipocalin (NGAL), osteopontin (OPN), kidney injury molecule-1 (KIM-1) and galectin-3 (Gal-3). The concentrations of all studied molecules were normalized to urine creatinine levels. In 10 patients, post-treatment levels of the biomarkers were measured. RESULTS: Normalized u-Gal-3BP levels were higher in LN patients compared to the other groups (p < .0001). Comparing different LN classes, u-Gal-3BP levels were higher among patients with proliferative (class III/IV) and membranous (class V) as compared to mesangial (class II) forms (p = .04). In proliferative forms, u-Gal-3BP levels correlated with the activity index in renal biopsies (r = 0.42, p = .004). Moreover, in a subset of 10 patients with repeated kidney biopsy and urine sampling before and after induction treatment, a significant decrease of u-Gal-3BP was observed (p = .03). Among the other markers, KIM-1 was also able to discriminate LN from the other groups, while NGAL, OPN and Gal-3 could not in this cohort. CONCLUSION: Given its ability to discriminate LN patients from active non-renal and inactive SLE patients, the observed correlation with the activity index in renal biopsies, and its levels declining following treatment, u-Gal-3BP shows promise as a non-invasive urinary biomarker to help detecting and to monitor renal involvement in SLE patients and should be validated in larger cohorts. SAGE Publications 2022-12-12 2023-02 /pmc/articles/PMC9939930/ /pubmed/36508734 http://dx.doi.org/10.1177/09612033221145534 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution 4.0 License (https://creativecommons.org/licenses/by/4.0/) which permits any use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access page (https://us.sagepub.com/en-us/nam/open-access-at-sage).
spellingShingle Papers
Faustini, Francesca
Idborg, Helena
Fuzzi, Enrico
Larsson, Anders
Lie, Wen-Rong
Pötzsch, Sven
Okitsu, Shinji L
Svenungsson, Elisabet
Gunnarsson, Iva
Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title_full Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title_fullStr Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title_full_unstemmed Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title_short Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
title_sort urine galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
topic Papers
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9939930/
https://www.ncbi.nlm.nih.gov/pubmed/36508734
http://dx.doi.org/10.1177/09612033221145534
work_keys_str_mv AT faustinifrancesca urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT idborghelena urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT fuzzienrico urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT larssonanders urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT liewenrong urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT potzschsven urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT okitsushinjil urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT svenungssonelisabet urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus
AT gunnarssoniva urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus