Cargando…
Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus
BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosi...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
SAGE Publications
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9939930/ https://www.ncbi.nlm.nih.gov/pubmed/36508734 http://dx.doi.org/10.1177/09612033221145534 |
_version_ | 1784890971642658816 |
---|---|
author | Faustini, Francesca Idborg, Helena Fuzzi, Enrico Larsson, Anders Lie, Wen-Rong Pötzsch, Sven Okitsu, Shinji L Svenungsson, Elisabet Gunnarsson, Iva |
author_facet | Faustini, Francesca Idborg, Helena Fuzzi, Enrico Larsson, Anders Lie, Wen-Rong Pötzsch, Sven Okitsu, Shinji L Svenungsson, Elisabet Gunnarsson, Iva |
author_sort | Faustini, Francesca |
collection | PubMed |
description | BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosis and management. OBJECTIVE: To investigate the role of urinary galectin-3 binding protein (u-Gal-3BP) as a candidate biomarker of renal disease in biopsy proven LN. PATIENTS AND METHODS: Levels of u-Gal-3BP were investigated in a cross-sectional fashion by ELISA in 270 subjects: 86 LN patients, 63 active SLE patients with no kidney involvement, 73 SLE patients with inactive disease and 48 age and sex-matched population-based controls (PBC). Moreover, urine samples were analysed separately by ELISA for additional markers of kidney pathology: neutrophil gelatinase-associated lipocalin (NGAL), osteopontin (OPN), kidney injury molecule-1 (KIM-1) and galectin-3 (Gal-3). The concentrations of all studied molecules were normalized to urine creatinine levels. In 10 patients, post-treatment levels of the biomarkers were measured. RESULTS: Normalized u-Gal-3BP levels were higher in LN patients compared to the other groups (p < .0001). Comparing different LN classes, u-Gal-3BP levels were higher among patients with proliferative (class III/IV) and membranous (class V) as compared to mesangial (class II) forms (p = .04). In proliferative forms, u-Gal-3BP levels correlated with the activity index in renal biopsies (r = 0.42, p = .004). Moreover, in a subset of 10 patients with repeated kidney biopsy and urine sampling before and after induction treatment, a significant decrease of u-Gal-3BP was observed (p = .03). Among the other markers, KIM-1 was also able to discriminate LN from the other groups, while NGAL, OPN and Gal-3 could not in this cohort. CONCLUSION: Given its ability to discriminate LN patients from active non-renal and inactive SLE patients, the observed correlation with the activity index in renal biopsies, and its levels declining following treatment, u-Gal-3BP shows promise as a non-invasive urinary biomarker to help detecting and to monitor renal involvement in SLE patients and should be validated in larger cohorts. |
format | Online Article Text |
id | pubmed-9939930 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | SAGE Publications |
record_format | MEDLINE/PubMed |
spelling | pubmed-99399302023-02-21 Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus Faustini, Francesca Idborg, Helena Fuzzi, Enrico Larsson, Anders Lie, Wen-Rong Pötzsch, Sven Okitsu, Shinji L Svenungsson, Elisabet Gunnarsson, Iva Lupus Papers BACKGROUND: Lupus nephritis (LN) is a major and severe organ involvement in systemic lupus erythematosus (SLE), whose diagnosis and treatment necessitate to perform kidney biopsy, which is an invasive procedure. Non-invasive urine biomarkers are an active area of investigation to support LN diagnosis and management. OBJECTIVE: To investigate the role of urinary galectin-3 binding protein (u-Gal-3BP) as a candidate biomarker of renal disease in biopsy proven LN. PATIENTS AND METHODS: Levels of u-Gal-3BP were investigated in a cross-sectional fashion by ELISA in 270 subjects: 86 LN patients, 63 active SLE patients with no kidney involvement, 73 SLE patients with inactive disease and 48 age and sex-matched population-based controls (PBC). Moreover, urine samples were analysed separately by ELISA for additional markers of kidney pathology: neutrophil gelatinase-associated lipocalin (NGAL), osteopontin (OPN), kidney injury molecule-1 (KIM-1) and galectin-3 (Gal-3). The concentrations of all studied molecules were normalized to urine creatinine levels. In 10 patients, post-treatment levels of the biomarkers were measured. RESULTS: Normalized u-Gal-3BP levels were higher in LN patients compared to the other groups (p < .0001). Comparing different LN classes, u-Gal-3BP levels were higher among patients with proliferative (class III/IV) and membranous (class V) as compared to mesangial (class II) forms (p = .04). In proliferative forms, u-Gal-3BP levels correlated with the activity index in renal biopsies (r = 0.42, p = .004). Moreover, in a subset of 10 patients with repeated kidney biopsy and urine sampling before and after induction treatment, a significant decrease of u-Gal-3BP was observed (p = .03). Among the other markers, KIM-1 was also able to discriminate LN from the other groups, while NGAL, OPN and Gal-3 could not in this cohort. CONCLUSION: Given its ability to discriminate LN patients from active non-renal and inactive SLE patients, the observed correlation with the activity index in renal biopsies, and its levels declining following treatment, u-Gal-3BP shows promise as a non-invasive urinary biomarker to help detecting and to monitor renal involvement in SLE patients and should be validated in larger cohorts. SAGE Publications 2022-12-12 2023-02 /pmc/articles/PMC9939930/ /pubmed/36508734 http://dx.doi.org/10.1177/09612033221145534 Text en © The Author(s) 2022 https://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution 4.0 License (https://creativecommons.org/licenses/by/4.0/) which permits any use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access page (https://us.sagepub.com/en-us/nam/open-access-at-sage). |
spellingShingle | Papers Faustini, Francesca Idborg, Helena Fuzzi, Enrico Larsson, Anders Lie, Wen-Rong Pötzsch, Sven Okitsu, Shinji L Svenungsson, Elisabet Gunnarsson, Iva Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title | Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title_full | Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title_fullStr | Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title_full_unstemmed | Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title_short | Urine Galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
title_sort | urine galectin-3 binding protein reflects nephritis activity in systemic lupus erythematosus |
topic | Papers |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9939930/ https://www.ncbi.nlm.nih.gov/pubmed/36508734 http://dx.doi.org/10.1177/09612033221145534 |
work_keys_str_mv | AT faustinifrancesca urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT idborghelena urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT fuzzienrico urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT larssonanders urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT liewenrong urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT potzschsven urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT okitsushinjil urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT svenungssonelisabet urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus AT gunnarssoniva urinegalectin3bindingproteinreflectsnephritisactivityinsystemiclupuserythematosus |