Cargando…

Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review

BACKGROUND: Malaria in pregnancy (MIP) increases the risk of poor maternal and infant outcomes. To reduce these risks, WHO recommends insecticide-treated net (ITN) use, intermittent preventive treatment during pregnancy (IPTp) with sulfadoxine-pyrimethamine (SP), and prompt case management. However,...

Descripción completa

Detalles Bibliográficos
Autores principales: Malpass, Ashley, Hansen, Natasha, Dentinger, Catherine M., Youll, Susan, Cotte, Annett, Mattern, Chiarella, Ravaoarinosy, Aimée
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9940392/
https://www.ncbi.nlm.nih.gov/pubmed/36803987
http://dx.doi.org/10.1186/s12936-023-04497-3
_version_ 1784891068322414592
author Malpass, Ashley
Hansen, Natasha
Dentinger, Catherine M.
Youll, Susan
Cotte, Annett
Mattern, Chiarella
Ravaoarinosy, Aimée
author_facet Malpass, Ashley
Hansen, Natasha
Dentinger, Catherine M.
Youll, Susan
Cotte, Annett
Mattern, Chiarella
Ravaoarinosy, Aimée
author_sort Malpass, Ashley
collection PubMed
description BACKGROUND: Malaria in pregnancy (MIP) increases the risk of poor maternal and infant outcomes. To reduce these risks, WHO recommends insecticide-treated net (ITN) use, intermittent preventive treatment during pregnancy (IPTp) with sulfadoxine-pyrimethamine (SP), and prompt case management. However, uptake of these interventions remains sub-optimal in Madagascar. A scoping review was conducted to determine the breadth and depth of information available during 2010–2021 about Madagascar’s MIP activities and to identify barriers and facilitators to MIP interventions uptake. METHODS: PubMed, Google Scholar, and USAID’s files (Development Experience Catalog) were searched using the terms “Madagascar AND pregnancy AND malaria,” and reports and materials from stakeholders were collected. Documents in English and French from 2010 to 2021 with data regarding MIP were included. Documents were systematically reviewed and summarized; results were captured in an Excel database. RESULTS: Of 91 project reports, surveys and published articles, 23 (25%) fell within the stated time period and contained relevant data on MIP activities in Madagascar and were categorized accordingly: eight (35%) quality of care, including health facility readiness, provider knowledge and commodity availability; nine (39%) care-seeking behaviour; and, six (26%) prevention of MIP. Key barriers were identified: nine articles mentioned SP stockouts; seven found limitations of provider knowledge, attitudes, and behaviours (KAB) regarding MIP treatment and prevention; and, one reported limited supervision. MIP care seeking and prevention barriers and facilitators included women’s KAB regarding MIP treatment and prevention, distance, wait times, poor service quality, cost, and/or unwelcoming providers. A 2015 survey of 52 health facilities revealed limited client access to antenatal care due to financial and geographic barriers; two 2018 surveys revealed similar findings. Self-treatment and care-seeking delays were reported even when distance was not a barrier. CONCLUSION: Among the studies and reports on MIP in Madagascar, the scoping review frequently noted barriers that could be mitigated by reducing stockouts, improving provider knowledge and attitudes, refining MIP communication, and improving service access. There is a need for coordinated efforts to address the identified barriers is the key implication of the findings.
format Online
Article
Text
id pubmed-9940392
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-99403922023-02-21 Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review Malpass, Ashley Hansen, Natasha Dentinger, Catherine M. Youll, Susan Cotte, Annett Mattern, Chiarella Ravaoarinosy, Aimée Malar J Review BACKGROUND: Malaria in pregnancy (MIP) increases the risk of poor maternal and infant outcomes. To reduce these risks, WHO recommends insecticide-treated net (ITN) use, intermittent preventive treatment during pregnancy (IPTp) with sulfadoxine-pyrimethamine (SP), and prompt case management. However, uptake of these interventions remains sub-optimal in Madagascar. A scoping review was conducted to determine the breadth and depth of information available during 2010–2021 about Madagascar’s MIP activities and to identify barriers and facilitators to MIP interventions uptake. METHODS: PubMed, Google Scholar, and USAID’s files (Development Experience Catalog) were searched using the terms “Madagascar AND pregnancy AND malaria,” and reports and materials from stakeholders were collected. Documents in English and French from 2010 to 2021 with data regarding MIP were included. Documents were systematically reviewed and summarized; results were captured in an Excel database. RESULTS: Of 91 project reports, surveys and published articles, 23 (25%) fell within the stated time period and contained relevant data on MIP activities in Madagascar and were categorized accordingly: eight (35%) quality of care, including health facility readiness, provider knowledge and commodity availability; nine (39%) care-seeking behaviour; and, six (26%) prevention of MIP. Key barriers were identified: nine articles mentioned SP stockouts; seven found limitations of provider knowledge, attitudes, and behaviours (KAB) regarding MIP treatment and prevention; and, one reported limited supervision. MIP care seeking and prevention barriers and facilitators included women’s KAB regarding MIP treatment and prevention, distance, wait times, poor service quality, cost, and/or unwelcoming providers. A 2015 survey of 52 health facilities revealed limited client access to antenatal care due to financial and geographic barriers; two 2018 surveys revealed similar findings. Self-treatment and care-seeking delays were reported even when distance was not a barrier. CONCLUSION: Among the studies and reports on MIP in Madagascar, the scoping review frequently noted barriers that could be mitigated by reducing stockouts, improving provider knowledge and attitudes, refining MIP communication, and improving service access. There is a need for coordinated efforts to address the identified barriers is the key implication of the findings. BioMed Central 2023-02-20 /pmc/articles/PMC9940392/ /pubmed/36803987 http://dx.doi.org/10.1186/s12936-023-04497-3 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Malpass, Ashley
Hansen, Natasha
Dentinger, Catherine M.
Youll, Susan
Cotte, Annett
Mattern, Chiarella
Ravaoarinosy, Aimée
Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title_full Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title_fullStr Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title_full_unstemmed Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title_short Status of malaria in pregnancy services in Madagascar 2010–2021: a scoping review
title_sort status of malaria in pregnancy services in madagascar 2010–2021: a scoping review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9940392/
https://www.ncbi.nlm.nih.gov/pubmed/36803987
http://dx.doi.org/10.1186/s12936-023-04497-3
work_keys_str_mv AT malpassashley statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT hansennatasha statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT dentingercatherinem statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT youllsusan statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT cotteannett statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT matternchiarella statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview
AT ravaoarinosyaimee statusofmalariainpregnancyservicesinmadagascar20102021ascopingreview