Cargando…
Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9954241/ https://www.ncbi.nlm.nih.gov/pubmed/36831279 http://dx.doi.org/10.3390/cells12040612 |
_version_ | 1784894073892503552 |
---|---|
author | Miyazaki, Katsuki Morine, Yuji Xu, Caiming Nakasu, Chiharu Wada, Yuma Teraoku, Hiroki Yamada, Shinichiro Saito, Yu Ikemoto, Tetsuya Shimada, Mitsuo Goel, Ajay |
author_facet | Miyazaki, Katsuki Morine, Yuji Xu, Caiming Nakasu, Chiharu Wada, Yuma Teraoku, Hiroki Yamada, Shinichiro Saito, Yu Ikemoto, Tetsuya Shimada, Mitsuo Goel, Ajay |
author_sort | Miyazaki, Katsuki |
collection | PubMed |
description | Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients with HCC. Recent evidence suggests that epidermal growth factor receptor (EGFR) activation can trigger Lenvatinib-resistance; and is considered an important therapeutic target in HCC. Curcumin, one of the most studied naturally occurring botanicals with robust anti-cancer activity, is also reported to be a potent tyrosine kinase inhibitor. In this study, we hypothesized that the anti-EGFR potential of Curcumin might help overcome Lenvatinib resistance in HCC. We established two Lenvatinib-resistant cells and discovered that a combination of Curcumin and Lenvatinib exhibited a synergistic anti-tumor efficacy in the resistant HCC cell lines. In line with previous reports, Lenvatinib-resistant cell lines revealed significant activation of the EGFR, and genomewide transcriptomic profiling analysis identified that the PI3K-AKT pathway was associated with Lenvatinib resistance. The combination treatment with Curcumin and Lenvatinib dramatically suppressed gene and protein expression of the EGFR-PI3K-AKT pathway, suggesting Curcumin overcomes Lenvatinib resistance via inhibition of EGFR. We further validated these findings in tumor spheroids derived from resistant cell lines. In conclusion, we, for the first time, report that Curcumin reverses Lenvatinib resistance in HCC, and that their combination has clinical application potential for adjunctive treatment in HCC. |
format | Online Article Text |
id | pubmed-9954241 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-99542412023-02-25 Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma Miyazaki, Katsuki Morine, Yuji Xu, Caiming Nakasu, Chiharu Wada, Yuma Teraoku, Hiroki Yamada, Shinichiro Saito, Yu Ikemoto, Tetsuya Shimada, Mitsuo Goel, Ajay Cells Article Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients with HCC. Recent evidence suggests that epidermal growth factor receptor (EGFR) activation can trigger Lenvatinib-resistance; and is considered an important therapeutic target in HCC. Curcumin, one of the most studied naturally occurring botanicals with robust anti-cancer activity, is also reported to be a potent tyrosine kinase inhibitor. In this study, we hypothesized that the anti-EGFR potential of Curcumin might help overcome Lenvatinib resistance in HCC. We established two Lenvatinib-resistant cells and discovered that a combination of Curcumin and Lenvatinib exhibited a synergistic anti-tumor efficacy in the resistant HCC cell lines. In line with previous reports, Lenvatinib-resistant cell lines revealed significant activation of the EGFR, and genomewide transcriptomic profiling analysis identified that the PI3K-AKT pathway was associated with Lenvatinib resistance. The combination treatment with Curcumin and Lenvatinib dramatically suppressed gene and protein expression of the EGFR-PI3K-AKT pathway, suggesting Curcumin overcomes Lenvatinib resistance via inhibition of EGFR. We further validated these findings in tumor spheroids derived from resistant cell lines. In conclusion, we, for the first time, report that Curcumin reverses Lenvatinib resistance in HCC, and that their combination has clinical application potential for adjunctive treatment in HCC. MDPI 2023-02-14 /pmc/articles/PMC9954241/ /pubmed/36831279 http://dx.doi.org/10.3390/cells12040612 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Miyazaki, Katsuki Morine, Yuji Xu, Caiming Nakasu, Chiharu Wada, Yuma Teraoku, Hiroki Yamada, Shinichiro Saito, Yu Ikemoto, Tetsuya Shimada, Mitsuo Goel, Ajay Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title_full | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title_fullStr | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title_full_unstemmed | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title_short | Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma |
title_sort | curcumin-mediated resistance to lenvatinib via egfr signaling pathway in hepatocellular carcinoma |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9954241/ https://www.ncbi.nlm.nih.gov/pubmed/36831279 http://dx.doi.org/10.3390/cells12040612 |
work_keys_str_mv | AT miyazakikatsuki curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT morineyuji curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT xucaiming curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT nakasuchiharu curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT wadayuma curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT teraokuhiroki curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT yamadashinichiro curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT saitoyu curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT ikemototetsuya curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT shimadamitsuo curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma AT goelajay curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma |