Cargando…

Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma

Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients...

Descripción completa

Detalles Bibliográficos
Autores principales: Miyazaki, Katsuki, Morine, Yuji, Xu, Caiming, Nakasu, Chiharu, Wada, Yuma, Teraoku, Hiroki, Yamada, Shinichiro, Saito, Yu, Ikemoto, Tetsuya, Shimada, Mitsuo, Goel, Ajay
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9954241/
https://www.ncbi.nlm.nih.gov/pubmed/36831279
http://dx.doi.org/10.3390/cells12040612
_version_ 1784894073892503552
author Miyazaki, Katsuki
Morine, Yuji
Xu, Caiming
Nakasu, Chiharu
Wada, Yuma
Teraoku, Hiroki
Yamada, Shinichiro
Saito, Yu
Ikemoto, Tetsuya
Shimada, Mitsuo
Goel, Ajay
author_facet Miyazaki, Katsuki
Morine, Yuji
Xu, Caiming
Nakasu, Chiharu
Wada, Yuma
Teraoku, Hiroki
Yamada, Shinichiro
Saito, Yu
Ikemoto, Tetsuya
Shimada, Mitsuo
Goel, Ajay
author_sort Miyazaki, Katsuki
collection PubMed
description Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients with HCC. Recent evidence suggests that epidermal growth factor receptor (EGFR) activation can trigger Lenvatinib-resistance; and is considered an important therapeutic target in HCC. Curcumin, one of the most studied naturally occurring botanicals with robust anti-cancer activity, is also reported to be a potent tyrosine kinase inhibitor. In this study, we hypothesized that the anti-EGFR potential of Curcumin might help overcome Lenvatinib resistance in HCC. We established two Lenvatinib-resistant cells and discovered that a combination of Curcumin and Lenvatinib exhibited a synergistic anti-tumor efficacy in the resistant HCC cell lines. In line with previous reports, Lenvatinib-resistant cell lines revealed significant activation of the EGFR, and genomewide transcriptomic profiling analysis identified that the PI3K-AKT pathway was associated with Lenvatinib resistance. The combination treatment with Curcumin and Lenvatinib dramatically suppressed gene and protein expression of the EGFR-PI3K-AKT pathway, suggesting Curcumin overcomes Lenvatinib resistance via inhibition of EGFR. We further validated these findings in tumor spheroids derived from resistant cell lines. In conclusion, we, for the first time, report that Curcumin reverses Lenvatinib resistance in HCC, and that their combination has clinical application potential for adjunctive treatment in HCC.
format Online
Article
Text
id pubmed-9954241
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-99542412023-02-25 Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma Miyazaki, Katsuki Morine, Yuji Xu, Caiming Nakasu, Chiharu Wada, Yuma Teraoku, Hiroki Yamada, Shinichiro Saito, Yu Ikemoto, Tetsuya Shimada, Mitsuo Goel, Ajay Cells Article Lenvatinib is a multi-kinase inhibitor approved as a first-line treatment for patients with unresectable advanced hepatocellular carcinoma (HCC). However, its response rate is unsatisfactory, primarily due to the acquisition of resistance, which limits its clinical significance for treating patients with HCC. Recent evidence suggests that epidermal growth factor receptor (EGFR) activation can trigger Lenvatinib-resistance; and is considered an important therapeutic target in HCC. Curcumin, one of the most studied naturally occurring botanicals with robust anti-cancer activity, is also reported to be a potent tyrosine kinase inhibitor. In this study, we hypothesized that the anti-EGFR potential of Curcumin might help overcome Lenvatinib resistance in HCC. We established two Lenvatinib-resistant cells and discovered that a combination of Curcumin and Lenvatinib exhibited a synergistic anti-tumor efficacy in the resistant HCC cell lines. In line with previous reports, Lenvatinib-resistant cell lines revealed significant activation of the EGFR, and genomewide transcriptomic profiling analysis identified that the PI3K-AKT pathway was associated with Lenvatinib resistance. The combination treatment with Curcumin and Lenvatinib dramatically suppressed gene and protein expression of the EGFR-PI3K-AKT pathway, suggesting Curcumin overcomes Lenvatinib resistance via inhibition of EGFR. We further validated these findings in tumor spheroids derived from resistant cell lines. In conclusion, we, for the first time, report that Curcumin reverses Lenvatinib resistance in HCC, and that their combination has clinical application potential for adjunctive treatment in HCC. MDPI 2023-02-14 /pmc/articles/PMC9954241/ /pubmed/36831279 http://dx.doi.org/10.3390/cells12040612 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Miyazaki, Katsuki
Morine, Yuji
Xu, Caiming
Nakasu, Chiharu
Wada, Yuma
Teraoku, Hiroki
Yamada, Shinichiro
Saito, Yu
Ikemoto, Tetsuya
Shimada, Mitsuo
Goel, Ajay
Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title_full Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title_fullStr Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title_full_unstemmed Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title_short Curcumin-Mediated Resistance to Lenvatinib via EGFR Signaling Pathway in Hepatocellular Carcinoma
title_sort curcumin-mediated resistance to lenvatinib via egfr signaling pathway in hepatocellular carcinoma
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9954241/
https://www.ncbi.nlm.nih.gov/pubmed/36831279
http://dx.doi.org/10.3390/cells12040612
work_keys_str_mv AT miyazakikatsuki curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT morineyuji curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT xucaiming curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT nakasuchiharu curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT wadayuma curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT teraokuhiroki curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT yamadashinichiro curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT saitoyu curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT ikemototetsuya curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT shimadamitsuo curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma
AT goelajay curcuminmediatedresistancetolenvatinibviaegfrsignalingpathwayinhepatocellularcarcinoma