Cargando…
Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review
BACKGROUND: Several extended and newly added pharmacy services were evaluated in different countries. This review aims to provide a summary of studies on attitudes, awareness, or perceptions toward various extended and drive-thru pharmacy services at community settings among pharmacists and the gene...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9979876/ https://www.ncbi.nlm.nih.gov/pubmed/36864499 http://dx.doi.org/10.1186/s40545-023-00525-4 |
_version_ | 1784899804730490880 |
---|---|
author | Ababneh, Bayan F. Ong, Siew Chin Mahmoud, Fatema Alsaloumi, Louai Hussain, Rabia |
author_facet | Ababneh, Bayan F. Ong, Siew Chin Mahmoud, Fatema Alsaloumi, Louai Hussain, Rabia |
author_sort | Ababneh, Bayan F. |
collection | PubMed |
description | BACKGROUND: Several extended and newly added pharmacy services were evaluated in different countries. This review aims to provide a summary of studies on attitudes, awareness, or perceptions toward various extended and drive-thru pharmacy services at community settings among pharmacists and the general public. METHODS: To find qualitative and descriptive quantitative studies, that reported on the attitudes, awareness, or perceptions of the general public and pharmacists toward the practice of any extended community pharmacy service and drive-thru pharmacy services in a community setting and conducted from March 2012 to March 2022. Researchers used databases such as Embase, Medline PubMed, Scopus, Web of Science, and Science Direct. The reviewers extracted data independently using the PRISMA checklist. RESULTS: There were 55 studies found according to the inclusion criteria. Various extended pharmacy services (EPS) and drive-thru pharmacy services were noted in the community setting. Pharmaceutical care services and healthcare promotion services were the noticeable performed extended services. There were positive perceptions and attitudes toward extended and drive-thru pharmacy services among pharmacists and the public. However, some factors, such as lack of time and shortage of staff, affect the practice of those services. CONCLUSION: Understanding the major concerns toward the provision of extended and drive-thru community pharmacy services and improving pharmacists’ skills through more training programs to provide such services efficiently. In the future, more reviews for EPS practice barriers are recommended to faceup all concerns and find standardized guidelines by stakeholders and organizations for efficient EPS practices. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40545-023-00525-4. |
format | Online Article Text |
id | pubmed-9979876 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-99798762023-03-03 Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review Ababneh, Bayan F. Ong, Siew Chin Mahmoud, Fatema Alsaloumi, Louai Hussain, Rabia J Pharm Policy Pract Review BACKGROUND: Several extended and newly added pharmacy services were evaluated in different countries. This review aims to provide a summary of studies on attitudes, awareness, or perceptions toward various extended and drive-thru pharmacy services at community settings among pharmacists and the general public. METHODS: To find qualitative and descriptive quantitative studies, that reported on the attitudes, awareness, or perceptions of the general public and pharmacists toward the practice of any extended community pharmacy service and drive-thru pharmacy services in a community setting and conducted from March 2012 to March 2022. Researchers used databases such as Embase, Medline PubMed, Scopus, Web of Science, and Science Direct. The reviewers extracted data independently using the PRISMA checklist. RESULTS: There were 55 studies found according to the inclusion criteria. Various extended pharmacy services (EPS) and drive-thru pharmacy services were noted in the community setting. Pharmaceutical care services and healthcare promotion services were the noticeable performed extended services. There were positive perceptions and attitudes toward extended and drive-thru pharmacy services among pharmacists and the public. However, some factors, such as lack of time and shortage of staff, affect the practice of those services. CONCLUSION: Understanding the major concerns toward the provision of extended and drive-thru community pharmacy services and improving pharmacists’ skills through more training programs to provide such services efficiently. In the future, more reviews for EPS practice barriers are recommended to faceup all concerns and find standardized guidelines by stakeholders and organizations for efficient EPS practices. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40545-023-00525-4. BioMed Central 2023-03-02 /pmc/articles/PMC9979876/ /pubmed/36864499 http://dx.doi.org/10.1186/s40545-023-00525-4 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Ababneh, Bayan F. Ong, Siew Chin Mahmoud, Fatema Alsaloumi, Louai Hussain, Rabia Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title | Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title_full | Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title_fullStr | Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title_full_unstemmed | Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title_short | Attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
title_sort | attitudes, awareness, and perceptions of general public and pharmacists toward the extended community pharmacy services and drive-thru pharmacy services: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9979876/ https://www.ncbi.nlm.nih.gov/pubmed/36864499 http://dx.doi.org/10.1186/s40545-023-00525-4 |
work_keys_str_mv | AT ababnehbayanf attitudesawarenessandperceptionsofgeneralpublicandpharmaciststowardtheextendedcommunitypharmacyservicesanddrivethrupharmacyservicesasystematicreview AT ongsiewchin attitudesawarenessandperceptionsofgeneralpublicandpharmaciststowardtheextendedcommunitypharmacyservicesanddrivethrupharmacyservicesasystematicreview AT mahmoudfatema attitudesawarenessandperceptionsofgeneralpublicandpharmaciststowardtheextendedcommunitypharmacyservicesanddrivethrupharmacyservicesasystematicreview AT alsaloumilouai attitudesawarenessandperceptionsofgeneralpublicandpharmaciststowardtheextendedcommunitypharmacyservicesanddrivethrupharmacyservicesasystematicreview AT hussainrabia attitudesawarenessandperceptionsofgeneralpublicandpharmaciststowardtheextendedcommunitypharmacyservicesanddrivethrupharmacyservicesasystematicreview |