Cargando…
Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review
BACKGROUND: Pregnancy-related acute kidney injury (PRAKI) is an important cause of fetomaternal mortality and morbidity in developing countries. We undertook a systematic review to identify the causes of PRAKI among obstetric patients in India. MATERIALS AND METHODS: We systematically searched PubMe...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Jaypee Brothers Medical Publishers
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9983668/ https://www.ncbi.nlm.nih.gov/pubmed/36876193 http://dx.doi.org/10.5005/jp-journals-10071-24325 |
_version_ | 1784900595047464960 |
---|---|
author | Gautam, Medhavi Saxena, Sulekha Saran, Sai Ahmed, Armin Pandey, Amita Mishra, Prabhakar Azim, Afzal |
author_facet | Gautam, Medhavi Saxena, Sulekha Saran, Sai Ahmed, Armin Pandey, Amita Mishra, Prabhakar Azim, Afzal |
author_sort | Gautam, Medhavi |
collection | PubMed |
description | BACKGROUND: Pregnancy-related acute kidney injury (PRAKI) is an important cause of fetomaternal mortality and morbidity in developing countries. We undertook a systematic review to identify the causes of PRAKI among obstetric patients in India. MATERIALS AND METHODS: We systematically searched PubMed, MEDLINE, Embase, and Google Scholar using appropriate search terminology between 1 January 2010 to 31 December 2021. Studies reporting the etiology of PRAKI among obstetric patients (pregnant and within 42 days postpartum) in India were included for evaluation. Studies done in any other geographical location besides India were excluded. We also excluded studies done in any one trimester or any specific subgroup of patients [e.g., postpartum acute kidney injury (AKI), postabortal AKI]. A five-point questionnaire was used to assess the risk of bias in included studies. The results were synthesized as per preferred reporting items for systematic reviews and meta-analyses (PRISMA) guidelines. RESULTS: A total number of 7 studies with 477 participants were included for analysis. All were single-center descriptive observational studies either done in tertiary care public or private hospitals. Sepsis (mean, 41.9%; median, 49.4%; and range, 6–56.1%) was the most common cause of PRAKI followed by hemorrhage (mean, 22.1%; median, 23.5%; and range, 8.3–38.5%) and pregnancy-induced hypertension (mean, 20.9%; median, 20.7; and range, 11.5–39%). Among these seven studies, five were of moderate quality, one was of high quality, and another one was of low quality. Our study is limited due to the lack of consensus definition of PRAKI in literature and heterogeneity in reporting methods. Our study highlights the need for a structured reporting format for PRAKI to understand the true disease burden and take control measures. CONCLUSION: There is a moderate quality of evidence to suggest that sepsis followed by hemorrhage and pregnancy-induced hypertension are the commonest causes of PRAKI in India. HOW TO CITE THIS ARTICLE: Gautam M, Saxena S, Saran S, Ahmed A, Pandey A, Mishra P, et al. Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review. Indian J Crit Care Med 2022;26(10):1141–1151. |
format | Online Article Text |
id | pubmed-9983668 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Jaypee Brothers Medical Publishers |
record_format | MEDLINE/PubMed |
spelling | pubmed-99836682023-03-04 Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review Gautam, Medhavi Saxena, Sulekha Saran, Sai Ahmed, Armin Pandey, Amita Mishra, Prabhakar Azim, Afzal Indian J Crit Care Med Systematic Review BACKGROUND: Pregnancy-related acute kidney injury (PRAKI) is an important cause of fetomaternal mortality and morbidity in developing countries. We undertook a systematic review to identify the causes of PRAKI among obstetric patients in India. MATERIALS AND METHODS: We systematically searched PubMed, MEDLINE, Embase, and Google Scholar using appropriate search terminology between 1 January 2010 to 31 December 2021. Studies reporting the etiology of PRAKI among obstetric patients (pregnant and within 42 days postpartum) in India were included for evaluation. Studies done in any other geographical location besides India were excluded. We also excluded studies done in any one trimester or any specific subgroup of patients [e.g., postpartum acute kidney injury (AKI), postabortal AKI]. A five-point questionnaire was used to assess the risk of bias in included studies. The results were synthesized as per preferred reporting items for systematic reviews and meta-analyses (PRISMA) guidelines. RESULTS: A total number of 7 studies with 477 participants were included for analysis. All were single-center descriptive observational studies either done in tertiary care public or private hospitals. Sepsis (mean, 41.9%; median, 49.4%; and range, 6–56.1%) was the most common cause of PRAKI followed by hemorrhage (mean, 22.1%; median, 23.5%; and range, 8.3–38.5%) and pregnancy-induced hypertension (mean, 20.9%; median, 20.7; and range, 11.5–39%). Among these seven studies, five were of moderate quality, one was of high quality, and another one was of low quality. Our study is limited due to the lack of consensus definition of PRAKI in literature and heterogeneity in reporting methods. Our study highlights the need for a structured reporting format for PRAKI to understand the true disease burden and take control measures. CONCLUSION: There is a moderate quality of evidence to suggest that sepsis followed by hemorrhage and pregnancy-induced hypertension are the commonest causes of PRAKI in India. HOW TO CITE THIS ARTICLE: Gautam M, Saxena S, Saran S, Ahmed A, Pandey A, Mishra P, et al. Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review. Indian J Crit Care Med 2022;26(10):1141–1151. Jaypee Brothers Medical Publishers 2022-10 /pmc/articles/PMC9983668/ /pubmed/36876193 http://dx.doi.org/10.5005/jp-journals-10071-24325 Text en Copyright © 2022; Jaypee Brothers Medical Publishers (P) Ltd. https://creativecommons.org/licenses/by-nc/4.0/© The Author(s). 2022 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (https://creativecommons.org/licenses/by-nc/4.0/), which permits unrestricted use, distribution, and non-commercial reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Systematic Review Gautam, Medhavi Saxena, Sulekha Saran, Sai Ahmed, Armin Pandey, Amita Mishra, Prabhakar Azim, Afzal Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title | Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title_full | Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title_fullStr | Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title_full_unstemmed | Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title_short | Etiology of Pregnancy-related Acute Kidney Injury among Obstetric Patients in India: A Systematic Review |
title_sort | etiology of pregnancy-related acute kidney injury among obstetric patients in india: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9983668/ https://www.ncbi.nlm.nih.gov/pubmed/36876193 http://dx.doi.org/10.5005/jp-journals-10071-24325 |
work_keys_str_mv | AT gautammedhavi etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT saxenasulekha etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT saransai etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT ahmedarmin etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT pandeyamita etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT mishraprabhakar etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview AT azimafzal etiologyofpregnancyrelatedacutekidneyinjuryamongobstetricpatientsinindiaasystematicreview |