Mostrando 741 - 760 Resultados de 985 Para Buscar '"insecta"', tiempo de consulta: 0.32s Limitar resultados
  1. 741
    “…We present a genome assembly from an individual male Pherbina coryleti (snail-killing fly; Arthropoda; Insecta; Diptera; Sciomyzidae). The genome sequence is 863 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  2. 742
    “…We present a genome assembly from an individual male Machimus atricapillus (the Kite-tailed Robberfly; Arthropoda; Insecta; Diptera; Asilidae). The genome sequence is 268.6 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  3. 743
    por Boyes, Douglas, Palmada-Flores, Marc
    Publicado 2022
    “…We present a genome assembly from an individual female Aplocera efformata (the lesser treble-bar; Arthropoda; Insecta; Lepidoptera; Geometridae). The genome sequence is 350 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  4. 744
    por Boyes, Douglas, Holland, Peter W. H.
    Publicado 2023
    “…We present a genome assembly from an individual male Zeuzera pyrina (the Leopard Moth, Arthropoda; Insecta; Lepidoptera; Cossidae). The genome sequence is 687 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  5. 745
    por Crowley, Liam M., Pointon, Damon-Lee
    Publicado 2023
    “…We present a genome assembly from an individual female Tiphia femorata (a beetle-killing wasp; Arthropoda; Insecta; Hymenoptera; Tiphilidae). The genome sequence is 276 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  6. 746
    por Broad, Gavin R.
    Publicado 2023
    “…We present a genome assembly from an individual female Hecatera dysodea (the Small Ranunculus; Arthropoda; Insecta; Lepidoptera; Noctuidae). The genome sequence is 640.9 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  7. 747
    por Štys, Pavel, Baňař, Petr
    Publicado 2018
    “…Xenicocephalustomhenryisp. n. (Insecta: Hemiptera: Heteroptera: Enicocephalomorpha: Enicocephalidae) is established for a single macropterous female from Ecuador. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  8. 748
    “…We present a genome assembly from an individual female Melitaea athalia (also known as Mellicta athalia; the heath fritillary; Arthropoda; Insecta; Lepidoptera; Nymphalidae). The genome sequence is 610 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  9. 749
    por Boyes, Douglas, Holland, Peter W.H.
    Publicado 2021
    “…We present a genome assembly from an individual male Thyatira batis (the peach-blossom moth; Arthropoda; Insecta; Lepidoptera; Drepanidae). The genome sequence is 315 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  10. 750
    “…We present a genome assembly from an individual male Aglais io (also known as Inachis io and Nymphalis io) (the European peacock; Arthropoda; Insecta; Lepidoptera; Nymphalidae). The genome sequence is 384 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  11. 751
    por Boyes, Douglas, Holland, Peter W.H.
    Publicado 2022
    “…We present a genome assembly from an individual female Phlogophora meticulosa (the angle shades; Arthropoda; Insecta; Lepidoptera; Noctuidae). The genome sequence is 539 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  12. 752
    “…We present a genome assembly from an individual male Plebejus argus (silver-studded blue; Arthropoda; Insecta; Lepidoptera; Lycaenidae). The genome sequence is 382 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  13. 753
    “…We present a genome assembly from an individual female Fabriciana adippe (the high brown fritillary; Arthropoda; Insecta; Lepidoptera; Nymphalidae). The genome sequence is 485 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  14. 754
    “…We present a genome assembly from an individual male Philonthus cognatus (a rove beetle; Arthropoda; Insecta; Coleoptera; Staphylinidae). The genome sequence is 1,030.6 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  15. 755
    “…We present a genome assembly from an individual female Ochlodes sylvanus, the Large Skipper (Arthropoda; Insecta; Lepidoptera; Hesperiidae). The genome sequence is 380 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  16. 756
    “…We present a genome assembly from an individual female Limenitis camilla (the white admiral; Arthropoda; Insecta; Lepidoptera; Nymphalidae). The genome sequence is 435 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  17. 757
    “…We present a genome assembly from an individual female Volucella inanis (the Lesser Hornet Hoverfly; Arthropoda; Insecta; Diptera; Syrphidae). The genome sequence is 961 megabases in span. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  18. 758
    “…The type specimens of Ephemeroptera (Insecta) housed at the Zoological Museum of Hamburg (ZMH) are compiled in this document. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  19. 759
    por Lohse, Konrad, Hayward, Alex, Ebdon, Sam
    Publicado 2021
    “…We present genome assemblies from a male and female Pieris napi (the green-veined white; Arthropoda; Insecta; Lepidoptera; Pieridae). The genome sequences of the male and female are 320 and 319 megabases in span, respectively. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  20. 760
    “…RESULTS: A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
Herramientas de búsqueda: RSS