“…O'Reilly Publishers, Sebastopol, CA, ] are also available to the users. Various output formats are supported and include text tables, XML documents, as well as various graphs to help interpret the results.…”
Enlace del recurso
Enlace del recurso
Enlace del recurso

“…First, Dover sole Microstomus pacificus, Pacific grenadier Coryphaenoides acrolepis, shortspine thornyhead Sebastolobus alascanus, and splitnose rockfish Sebastes diploproa had distinct, spatially-limited hotspots that were spatially consistent through time. …”
Enlace del recurso
Enlace del recurso
Enlace del recurso

“…Some authorities adhere to a traditional belief that all medals have been cast from the bronze of guns captured from the Russians at Sebastopol. Furthermore, controversy is attached to the authenticity of some VCs. …”
Enlace del recurso
Enlace del recurso
Enlace del recurso

“…The following 20 genera are treated as junior subjective synonyms: Leucochitonea Wallengren, 1857 of Abantis Hopffer, 1855; Sapaea Plötz, 1879 and Netrobalane Mabille, 1903 of Caprona Wallengren, 1857; Parasovia Devyatkin, 1996 of Sebastonyma Watson, 1893; Pemara Eliot, 1978 of Oerane Elwes and Edwards, 1897; Ankola Evans, 1937 of Pardaleodes Butler, 1870; Arotis Mabille, 1904 of Mnaseas Godman, 1901; Chalcone Evans, 1955, Hansa Evans, 1955, and Propertius Evans, 1955 of Metrocles Godman, 1900; Jongiana O. …”
Enlace del recurso
Enlace del recurso

“…In this study, the TFPI-2 homologue (SsTFPI-2) of black rockfish (Sebastods schegelii) was analyzed and characterized, and the biological functions of its C-terminal derived peptide TS40 (FVSRQSCMDVCAKGAKQHTSRGNVRRARRNRKNRITYLQA, corresponding to the amino acid sequence of 187-226) was investigated. …”
Enlace del recurso
Enlace del recurso
Enlace del recurso