Mostrando 141 - 160 Resultados de 2,407 Para Buscar 'Sebasto~', tiempo de consulta: 2.59s Limitar resultados
  1. 141
    por Sábato, Ernesto R.
    Publicado 1979
    Libro
  2. 142
    por Sábato, Ernesto R.
    Publicado 2000
    Libro
  3. 143
    por Sábato, Ernesto R.
    Publicado 1984
    Libro
  4. 144
    por Sábato, Ernesto R.
    Publicado 1985
    Libro
  5. 145
    por Sábato, Ernesto R.
    Publicado 1985
    Libro
  6. 146
    por Sábato, Ernesto R.
    Publicado 1974
    Libro
  7. 147
    por Sábato, Ernesto R.
    Publicado 1978
    Libro
  8. 148
    por Sábato, Ernesto R.
    Publicado 1993
    Libro
  9. 149
    “…Metazoan parasite community analysis and anisakid nematode population genetics based on a mitochondrial cytochrome marker were applied in order to assess the usefulness of the two parasitological methods for stock discrimination of beaked redfish Sebastes mentella of three fishing grounds in the North East Atlantic. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  10. 150
  11. 151
    “…In this study, the TFPI-2 homologue (SsTFPI-2) of black rockfish (Sebastods schegelii) was analyzed and characterized, and the biological functions of its C-terminal derived peptide TS40 (FVSRQSCMDVCAKGAKQHTSRGNVRRARRNRKNRITYLQA, corresponding to the amino acid sequence of 187-226) was investigated. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  12. 152
  13. 153
    por Mateus, Julião S.
    Publicado 2005
    Libro
  14. 154
    por López Rosado, Diego G.
    Publicado 1988
    “…El abasto de productos alimenticios en la ciudad de México.…”
    Libro
  15. 155
    por Salinas de Gortari, Raúl
    Publicado 1988
    Libro
  16. 156
    por Steinmann, Paul
    Publicado 2015
    “…Besides applications to first- order elasticity and elasto-plasticity an appreciation thereof is particularly illuminating for generalized models of continuum mechanics such as second-order (gradient-type) elasticity and elasto-plasticity.   …”
    Enlace del recurso
    Enlace del recurso
  17. 157
    “…Proceeds of the Third International Conference on Low Cycle Fatigue and Elasto-plastic Behaviour of Materials, Berlin Congress Center, Berlin, Germany, 7-11 September 1992.…”
    Enlace del recurso
    Enlace del recurso
  18. 158
    por Zhu, Xueyan, Yuan, Quanzi, Zhao, Ya-Pu
    Publicado 2012
    “…Molecular dynamics simulations were carried out to explore the capillary wave propagation induced by the competition between one upper precursor film (PF) on the graphene and one lower PF on the substrate in electro-elasto-capillarity (EEC). During the wave propagation, the graphene was gradually delaminated from the substrate by the lower PF. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
  19. 159
  20. 160
    “…Here, we apply epitaxial strain engineering to tune the optical response of BiFeO(3) thin films, and find a very large variation of the optical index with strain, corresponding to an effective elasto-optic coefficient larger than that of quartz. …”
    Enlace del recurso
    Enlace del recurso
    Enlace del recurso
    Online Artículo Texto
Herramientas de búsqueda: RSS