Cargando…

Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway

Chinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents o...

Descripción completa

Detalles Bibliográficos
Autores principales: Pungpuag, Siriphorn, Boonpangrak, Somchai, Suwanwong, Yaneenart
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10094306/
https://www.ncbi.nlm.nih.gov/pubmed/37048295
http://dx.doi.org/10.3390/foods12071471
_version_ 1785023809331396608
author Pungpuag, Siriphorn
Boonpangrak, Somchai
Suwanwong, Yaneenart
author_facet Pungpuag, Siriphorn
Boonpangrak, Somchai
Suwanwong, Yaneenart
author_sort Pungpuag, Siriphorn
collection PubMed
description Chinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents of glucosinolates and isothiocyanates, and the anti-leukemic activity of fresh and steamed Chinese kale juice (CKJ). Cell viability and proliferation activity of U937 cells treated with CKJ were determined. Cell apoptosis and alterations of apoptosis-related protein expression were studied. Results showed that CKJ significantly decreased the viability of leukemic cells and inhibited cell proliferation in a dose- and time-dependent manner. After treatment with 5% v/v fresh and steamed CKJ for 24 h, the percentage of apoptotic cells increased to 53% and 36%, respectively. Increased amounts of cleaved caspase-3 in U937 cells treated with CKJ were observed, indicating that CKJ can trigger apoptotic cell death through a caspase-dependent pathway. Fresh CKJ was found to be more effective than steamed CKJ in suppressing cell survival and inducing cell apoptosis. The results suggest that Chinese kale possesses an anti-leukemic potential and could be further developed for cancer therapy and prevention. However, thermal cooking could reduce its beneficial function.
format Online
Article
Text
id pubmed-10094306
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-100943062023-04-13 Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway Pungpuag, Siriphorn Boonpangrak, Somchai Suwanwong, Yaneenart Foods Article Chinese kale is a vegetable belonging to the family Brassicaceae in which members of this family produce unique metabolites called glucosinolates and isothiocyanates. These substances have been found to exhibit many benefits to human health. This study aimed to investigate and compare the contents of glucosinolates and isothiocyanates, and the anti-leukemic activity of fresh and steamed Chinese kale juice (CKJ). Cell viability and proliferation activity of U937 cells treated with CKJ were determined. Cell apoptosis and alterations of apoptosis-related protein expression were studied. Results showed that CKJ significantly decreased the viability of leukemic cells and inhibited cell proliferation in a dose- and time-dependent manner. After treatment with 5% v/v fresh and steamed CKJ for 24 h, the percentage of apoptotic cells increased to 53% and 36%, respectively. Increased amounts of cleaved caspase-3 in U937 cells treated with CKJ were observed, indicating that CKJ can trigger apoptotic cell death through a caspase-dependent pathway. Fresh CKJ was found to be more effective than steamed CKJ in suppressing cell survival and inducing cell apoptosis. The results suggest that Chinese kale possesses an anti-leukemic potential and could be further developed for cancer therapy and prevention. However, thermal cooking could reduce its beneficial function. MDPI 2023-03-30 /pmc/articles/PMC10094306/ /pubmed/37048295 http://dx.doi.org/10.3390/foods12071471 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Pungpuag, Siriphorn
Boonpangrak, Somchai
Suwanwong, Yaneenart
Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title_full Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title_fullStr Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title_full_unstemmed Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title_short Anti-Leukemic Effects on a U937 Cell Line of Fresh and Steamed Chinese Kale Juice and Their Pro-Apoptotic Effects via a Caspase-Dependent Pathway
title_sort anti-leukemic effects on a u937 cell line of fresh and steamed chinese kale juice and their pro-apoptotic effects via a caspase-dependent pathway
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10094306/
https://www.ncbi.nlm.nih.gov/pubmed/37048295
http://dx.doi.org/10.3390/foods12071471
work_keys_str_mv AT pungpuagsiriphorn antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway
AT boonpangraksomchai antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway
AT suwanwongyaneenart antileukemiceffectsonau937celllineoffreshandsteamedchinesekalejuiceandtheirproapoptoticeffectsviaacaspasedependentpathway