Cargando…
Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion
Sympathetic nerve loss in the heart predicts the risk of ventricular arrhythmias after myocardial infarction (MI) in patients. Sympathetic denervation after cardiac ischemia–reperfusion is sustained by matrix components chondroitin sulfate proteoglycans (CSPGs) in the cardiac scar. We showed that 4,...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10209516/ https://www.ncbi.nlm.nih.gov/pubmed/37226390 http://dx.doi.org/10.14814/phy2.15702 |
_version_ | 1785046892002934784 |
---|---|
author | Blake, Matthew R. Parrish, Diana C. Staffenson, Melanie A. Johnson, Morgan A. Woodward, William R. Habecker, Beth A. |
author_facet | Blake, Matthew R. Parrish, Diana C. Staffenson, Melanie A. Johnson, Morgan A. Woodward, William R. Habecker, Beth A. |
author_sort | Blake, Matthew R. |
collection | PubMed |
description | Sympathetic nerve loss in the heart predicts the risk of ventricular arrhythmias after myocardial infarction (MI) in patients. Sympathetic denervation after cardiac ischemia–reperfusion is sustained by matrix components chondroitin sulfate proteoglycans (CSPGs) in the cardiac scar. We showed that 4,6‐sulfation of CSPGs was critical for preventing nerve growth into the scar. Promoting early reinnervation with therapeutics reduces arrhythmias during the first 2 weeks after MI, but the longer‐term consequences of restoring innervation are unknown. Therefore, we asked if the beneficial effects of early reinnervation were sustained. We compared cardiac function and arrhythmia susceptibility 40 days after MI in mice treated on Days 3–10 with vehicle or with intracellular sigma peptide to restore innervation. Surprisingly, both groups had normal innervation density in the cardiac scar 40 days after MI, indicating delayed reinnervation of the infarct in vehicle‐treated mice. That coincided with similar cardiac function and arrhythmia susceptibility in the two groups. We investigated the mechanism allowing delayed reinnervation of the cardiac scar. We found that CSPG 4,6‐sulfation, which is elevated early after ischemia–reperfusion, was reduced to control levels allowing reinnervation of the infarct. Thus, remodeling of extracellular matrix weeks after injury leads to remodeling of sympathetic neurons in the heart. |
format | Online Article Text |
id | pubmed-10209516 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-102095162023-05-26 Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion Blake, Matthew R. Parrish, Diana C. Staffenson, Melanie A. Johnson, Morgan A. Woodward, William R. Habecker, Beth A. Physiol Rep Original Articles Sympathetic nerve loss in the heart predicts the risk of ventricular arrhythmias after myocardial infarction (MI) in patients. Sympathetic denervation after cardiac ischemia–reperfusion is sustained by matrix components chondroitin sulfate proteoglycans (CSPGs) in the cardiac scar. We showed that 4,6‐sulfation of CSPGs was critical for preventing nerve growth into the scar. Promoting early reinnervation with therapeutics reduces arrhythmias during the first 2 weeks after MI, but the longer‐term consequences of restoring innervation are unknown. Therefore, we asked if the beneficial effects of early reinnervation were sustained. We compared cardiac function and arrhythmia susceptibility 40 days after MI in mice treated on Days 3–10 with vehicle or with intracellular sigma peptide to restore innervation. Surprisingly, both groups had normal innervation density in the cardiac scar 40 days after MI, indicating delayed reinnervation of the infarct in vehicle‐treated mice. That coincided with similar cardiac function and arrhythmia susceptibility in the two groups. We investigated the mechanism allowing delayed reinnervation of the cardiac scar. We found that CSPG 4,6‐sulfation, which is elevated early after ischemia–reperfusion, was reduced to control levels allowing reinnervation of the infarct. Thus, remodeling of extracellular matrix weeks after injury leads to remodeling of sympathetic neurons in the heart. John Wiley and Sons Inc. 2023-05-24 /pmc/articles/PMC10209516/ /pubmed/37226390 http://dx.doi.org/10.14814/phy2.15702 Text en © 2023 The Authors. Physiological Reports published by Wiley Periodicals LLC on behalf of The Physiological Society and the American Physiological Society. https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Articles Blake, Matthew R. Parrish, Diana C. Staffenson, Melanie A. Johnson, Morgan A. Woodward, William R. Habecker, Beth A. Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title | Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title_full | Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title_fullStr | Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title_full_unstemmed | Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title_short | Loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
title_sort | loss of chondroitin sulfate proteoglycan sulfation allows delayed sympathetic reinnervation after cardiac ischemia–reperfusion |
topic | Original Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10209516/ https://www.ncbi.nlm.nih.gov/pubmed/37226390 http://dx.doi.org/10.14814/phy2.15702 |
work_keys_str_mv | AT blakematthewr lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion AT parrishdianac lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion AT staffensonmelaniea lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion AT johnsonmorgana lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion AT woodwardwilliamr lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion AT habeckerbetha lossofchondroitinsulfateproteoglycansulfationallowsdelayedsympatheticreinnervationaftercardiacischemiareperfusion |